Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.29
PubTator Score 3.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.003 5.6e-06
astrocytic glioma 1.300 4.2e-02
Becker muscular dystrophy -1.156 6.3e-04
Breast cancer -1.200 1.4e-09
dermatomyositis 1.300 7.3e-04
ependymoma 1.700 7.9e-03
glioblastoma -1.600 4.7e-04
intraductal papillary-mucinous adenoma (... 1.400 3.0e-03
intraductal papillary-mucinous carcinoma... 1.200 9.0e-03
invasive ductal carcinoma -1.200 1.4e-02
malignant mesothelioma 1.300 1.6e-06
medulloblastoma, large-cell -1.200 3.0e-03
non primary Sjogren syndrome sicca -1.100 2.3e-02
non-small cell lung cancer -1.745 8.4e-23
oligodendroglioma 2.100 9.2e-03
osteosarcoma -1.708 1.5e-03
ovarian cancer -1.200 2.0e-03
pancreatic ductal adenocarcinoma liver m... 1.163 3.4e-02
pediatric high grade glioma -1.200 3.1e-03
Pick disease -1.500 1.5e-05
progressive supranuclear palsy -1.700 4.9e-03
psoriasis -1.300 6.4e-06
Waldenstrons macroglobulinemia 1.270 1.7e-02

AA Sequence

MWDQGGQPWQQWPLNQQQWMQSFQHQQDPSQIDWAALAQAWIAQREASGQQSMVEQPPGMMPNGQDMSTM      1 - 70
ESGPNNHGNFQGDSNFNRMWQPEWGMHQQPPHPPPDQPWMPPTPGPMDIVPPSEDSNSQDSGEFAPDNRH     71 - 140
IFNQNNHNFGGPPDNFAVGPVNQFDYQHGAAFGPPQGGFHPPYWQPGPPGPPAPPQNRRERPSSFRDRQR    141 - 210
SPIALPVKQEPPQIDAVKRRTLPAWIREGLEKMEREKQKKLEKERMEQQRSQLSKKEKKATEDAEGGDGP    211 - 280
RLPQRSKFDSDEEEEDTENVEAASSGKVTRSPSPVPQEEHSDPEMTEEEKEYQMMLLTKMLLTEILLDVT    281 - 350
DEEIYYVAKDAHRKATKAPAKQLAQSSALASLTGLGGLGGYGSGDSEDERSDRGSESSDTDDEELRHRIR    351 - 420
QKQEAFWRKEKEQQLLHDKQMEEEKQQTERVTKEMNEFIHKEQNSLSLLEAREADGDVVNEKKRTPNETT    421 - 490
SVLEPKKEHKEKEKQGRSRSGSSSSGSSSSNSRTSSTSSTVSSSSYSSSSGSSRTSSRSSSPKRKKRHSR    491 - 560
SRSPTIKARRSRSRSYSRRIKIESNRARVKIRDRRRSNRNSIERERRRNRSPSRERRRSRSRSRDRRTNR    561 - 630
ASRSRSRDRRKIDDQRGNLSGNSHKHKGEAKEQERKKERSRSIDKDRKKKDKEREREQDKRKEKQKREEK    631 - 700
DFKFSSQDDRLKRKRESERTFSRSGSISVKIIRHDSRQDSKKSTTKDSKKHSGSDSSGRSSSESPGSSKE    701 - 770
KKAKKPKHSRSRSVEKSQRSGKKASRKHKSKSRSR                                       771 - 805
//

Text Mined References (19)

PMID Year Title