Property Summary

NCBI Gene PubMed Count 34
PubMed Score 24.76
PubTator Score 25.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.787 1.2e-02
active ulcerative colitis 1.998 6.3e-03
adrenocortical adenoma -1.163 4.0e-02
adrenocortical carcinoma -1.748 1.5e-05
atypical teratoid / rhabdoid tumor -1.300 3.5e-03
Breast cancer 1.200 4.9e-07
chronic lymphosyte leukemia -1.200 2.3e-10
colon cancer 1.100 1.1e-02
gastric carcinoma 2.600 4.4e-02
group 4 medulloblastoma -1.300 1.2e-02
interstitial cystitis 1.400 1.6e-02
invasive ductal carcinoma 1.098 9.3e-03
lung adenocarcinoma 1.500 4.0e-05
malignant mesothelioma -3.900 1.6e-08
medulloblastoma, large-cell -1.300 7.2e-04
non diabetic and post-ischemic heart fai... -1.200 1.4e-02
ovarian cancer 1.200 4.2e-04
pancreatic cancer 1.300 3.1e-04
pancreatic ductal adenocarcinoma liver m... 3.545 6.7e-03
tuberculosis -2.900 3.6e-09

Gene RIF (22)

AA Sequence

MHRLMGVNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELEFVQIIIIVVVMMVMVVVITCLLSHYKLSAR      1 - 70
SFISRHSQGRRREDALSSEGCLWPSESTVSGNGIPEPQVYAPPRPTDRLAVPPFAQRERFHRFQPTYPYL     71 - 140
QHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLMDSARLGGPCPPSS    141 - 210
NSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKD    211 - 280
KQKGHPL                                                                   281 - 287
//

Text Mined References (34)

PMID Year Title