Property Summary

NCBI Gene PubMed Count 26
PubMed Score 40.89
PubTator Score 26.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 5.400 1.5e-09
cystic fibrosis -1.129 1.2e-04
astrocytoma 1.100 2.2e-02
medulloblastoma, large-cell -1.500 7.6e-04
colon cancer 1.200 2.8e-02
interstitial cystitis 1.100 4.9e-04
group 4 medulloblastoma -1.700 2.6e-04
subependymal giant cell astrocytoma 1.610 4.7e-02
Breast cancer 1.300 8.5e-09
gastric carcinoma 1.200 8.7e-03
ulcerative colitis 1.100 2.6e-05
ovarian cancer 2.300 2.1e-07

Gene RIF (17)

PMID Text
26648031 Plexin D1 plays a role in collagen contraction in human lung fibroblasts.
26292963 Findings suggest that Plexin-D1/class III semaphorin (Sema3E) axis is triggered in systemic sclerosis (SSc) endothelium.
26068067 finding that PLXND1 and REV3L mutations are responsible for a proportion of MBS patients suggests that de novo mutations in other genes might account for other MBS patients
25976775 The data indicate that Plexin-D1 operates in a cell context-specific fashion, mediating different synaptogenic outcomes depending upon neuron type.
25831505 Plxnd1 is a novel regulator of VAT growth, body fat distribution, and insulin sensitivity in both zebrafish and humans
24841563 The identification and characterization of SH3BP1 as a novel downstream effector of Sema3E-PlexinD1 provides an explanation for how extracellular signals are translated into cytoskeletal changes and unique cell behavior.
24254849 It is therefore suggested that SEMA3C signaling, propagated through the heterodimer receptor plexin-D1/neuropilin, is important for truncus arteriosus septation
24139859 A critical role of Sema3E/Plexin D1 interaction in tumor resistance to apoptosis.
22738647 Strong expression of plexD1 was detected in endothelial cells of cervical cancer samples, yet no expression was seen in endothelial cells of normal cervical tissues, which suggests a potential role of PlexD1 in cervical cancer-associated angiogenesis
21795701 a novel phospholipid-regulated antiangiogenic signaling pathway whereby Sema3E activates Arf6 through Plexin-D1 and consequently controls integrin-mediated endothelial cell attachment to the extracellular matrix and migration.
21559368 analysis of Sema3E/plexin-D1 mediated epithelial-to-mesenchymal transition in ovarian endometrioid cancer
21505259 Sema3E-PlexinD1 signaling selectively suppresses disoriented angiogenesis in ischemic retinopathy in mice
20664171 Semaphorin 3E-Plexin D1 signaling in cancer cells is crucially implicated in their metastatic behavior and may therefore be a promising target for strategies aimed at blocking tumor metastasis.
20385769 Sema3E acts on plexin D1 to initiate a two-pronged mechanism involving R-Ras inactivation and Arf6 stimulation, which affect the status of activation of integrins and their intracellular trafficking, respectively.
19703316 Plexin D1 is abundantly expressed on tumor vasculature and malignant cells in the primary and metastatic tumors.
18974298 These results show that PLXND1 expression during tumor development is strongly correlated with both invasive behavior and metastasis, but exclude Sema3E as an activating ligand.
15301830 Results of extensive mutational analysis leads to the exclusion of the PLEXIN-D1 gene as the causative gene in Mobius syndrome 2, and in isolated Mobius syndrome.

AA Sequence

MAPRAAGGAPLSARAAAASPPPFQTPPRCPVPLLLLLLLGAARAGALEIQRRFPSPTPTNNFALDGAAGT      1 - 70
VYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRRLTDNYNKILQLDPGQGLVVVC     71 - 140
GSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSMLNVAANHPNASTVGLVLPPAAGAGGSRLLVG    141 - 210
ATYTGYGSSFFPRNRSLEDHRFENTPEIAIRSLDTRGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFV    211 - 280
SAFLHPSDPPPGAQSYAYLALNSEARAGDKESQARSLLARICLPHGAGGDAKKLTESYIQLGLQCAGGAG    281 - 350
RGDLYSRLVSVFPARERLFAVFERPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLD    351 - 420
SVVQGTGPACERKLNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLTSVAVASVNNYTAVFLGTV    421 - 490
NGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQMARVKVAACNVHSTCGDCVG    491 - 560
AADAYCGWCALETRCTLQQDCTNSSQQHFWTSASEGPSRCPAMTVLPSEIDVRQEYPGMILQISGSLPSL    561 - 630
SGMEMACDYGNNIRTVARVPGPAFGHQIAYCNLLPRDQFPPFPPNQDHVTVEMSVRVNGRNIVKANFTIY    631 - 700
DCSRTAQVYPHTACTSCLSAQWPCFWCSQQHSCVSNQSRCEASPNPTSPQDCPRTLLSPLAPVPTGGSQN    701 - 770
ILVPLANTAFFQGAALECSFGLEEIFEAVWVNESVVRCDQVVLHTTRKSQVFPLSLQLKGRPARFLDSPE    771 - 840
PMTVMVYNCAMGSPDCSQCLGREDLGHLCMWSDGCRLRGPLQPMAGTCPAPEIHAIEPLSGPLDGGTLLT    841 - 910
IRGRNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEEIVCVTGPAPGPLSGVVTVNASKEGKSRDRFSYVL    911 - 980
PLVHSLEPTMGPKAGGTRITIHGNDLHVGSELQVLVNDTDPCTELMRTDTSIACTMPEGALPAPVPVCVR    981 - 1050
FERRGCVHGNLTFWYMQNPVITAISPRRSPVSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNST   1051 - 1120
LITCPSPGALSNASAPVDFFINGRAYADEVAVAEELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHH   1121 - 1190
PGEPLTLVIHKEQDSLGLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAVGQLPITIQVGNFNQTI   1191 - 1260
ATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQ   1261 - 1330
TDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNSQGSSQAQETHPLLGEWKIPE   1331 - 1400
SCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKELLVDL   1401 - 1470
IDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYT   1471 - 1540
LSEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEW   1541 - 1610
FASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPT   1611 - 1680
DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEK   1681 - 1750
RGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTN   1751 - 1820
KLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIMA   1821 - 1890
ALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA                                      1891 - 1925
//

Text Mined References (28)

PMID Year Title
26648031 2015 Semaphorin 4A enhances lung fibrosis through activation of Akt via PlexinD1 receptor.
26292963 2015 Plexin-D1/Semaphorin 3E pathway may contribute to dysregulation of vascular tone control and defective angiogenesis in systemic sclerosis.
26068067 2015 De novo mutations in PLXND1 and REV3L cause Möbius syndrome.
25976775 2015 Positive regulation of neocortical synapse formation by the Plexin-D1 receptor.
25831505 2015 Plexin D1 determines body fat distribution by regulating the type V collagen microenvironment in visceral adipose tissue.
24841563 2014 An image-based RNAi screen identifies SH3BP1 as a key effector of Semaphorin 3E-PlexinD1 signaling.
24254849 2013 Isolated truncus arteriosus associated with a mutation in the plexin-D1 gene.
24139859 2013 Semaphorin 3E suppresses tumor cell death triggered by the plexin D1 dependence receptor in metastatic breast cancers.
22738647 2012 Plexin D1: new potential biomarker for cervical cancer.
21795701 2011 Phosphatidylinositol-4-phosphate 5-kinase and GEP100/Brag2 protein mediate antiangiogenic signaling by semaphorin 3E-plexin-D1 through Arf6 protein.
21559368 2011 Sema3E/plexin-D1 mediated epithelial-to-mesenchymal transition in ovarian endometrioid cancer.
21505259 2011 Sema3E-PlexinD1 signaling selectively suppresses disoriented angiogenesis in ischemic retinopathy in mice.
20664171 2010 Sema3E-Plexin D1 signaling drives human cancer cell invasiveness and metastatic spreading in mice.
20385769 2010 Semaphorin 3E initiates antiangiogenic signaling through plexin D1 by regulating Arf6 and R-Ras.
19703316 2009 Plexin D1 is ubiquitously expressed on tumor vessels and tumor cells in solid malignancies.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18974298 2008 Semaphorin 3E expression correlates inversely with Plexin D1 during tumor progression.
17318185 2007 Semaphorin-4A, an activator for T-cell-mediated immunity, suppresses angiogenesis via Plexin-D1.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15550623 2005 Semaphorin 3E and plexin-D1 control vascular pattern independently of neuropilins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15301830 2004 Sequence analysis of the PLEXIN-D1 gene in Möbius syndrome patients.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12412018 2002 PLEXIN-D1, a novel plexin family member, is expressed in vascular endothelium and the central nervous system during mouse embryogenesis.
10520995 1999 Plexins are a large family of receptors for transmembrane, secreted, and GPI-anchored semaphorins in vertebrates.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.