Property Summary

NCBI Gene PubMed Count 14
PubMed Score 223.27
PubTator Score 138.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
nephrosclerosis -1.117 3.6e-03
posterior fossa group A ependymoma -1.600 4.8e-09
glioblastoma -1.100 7.6e-04
intraductal papillary-mucinous adenoma (... 2.000 3.3e-03
intraductal papillary-mucinous carcinoma... 2.100 4.0e-03
intraductal papillary-mucinous neoplasm ... 3.400 2.2e-03
pancreatic cancer 1.700 2.8e-05
interstitial cystitis -3.700 2.0e-04
pilocytic astrocytoma -1.400 2.1e-04
nasopharyngeal carcinoma -1.400 9.9e-03
lung adenocarcinoma 1.064 3.6e-05
lung carcinoma 1.400 9.2e-13
spina bifida -1.792 3.1e-02
ductal carcinoma in situ 1.700 1.2e-02

Gene RIF (2)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with plastin 1 (PLS1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
12119179 HIV-1 gp41 is identified to have a physical interaction with plastin 1 (PLS1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGK      1 - 70
ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSYSEEEKVAFVNWINKALENDP     71 - 140
DCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDERAINKKKLTPFTISENLNLALNSASAIGCTV    141 - 210
VNIGASDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHL    211 - 280
TNAGWHTISNFSQDIKDSRAYFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQF    281 - 350
VTPADVVSGNPKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSD    351 - 420
LADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLNEGNST    421 - 490
LTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAI    491 - 560
APNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK     561 - 629
//

Text Mined References (19)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21490949 2011 Transferability of type 2 diabetes implicated loci in multi-ethnic cohorts from Southeast Asia.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8428952 1993 Human plastin genes. Comparative gene structure, chromosome location, and differential expression in normal and neoplastic cells.
8336074 1993 Characterization of a 64-kd protein phosphorylated during chemotactic activation with IL-8 and fMLP of human polymorphonuclear leukocytes. II. Purification and amino acid analysis of phosphorylated 64-kd protein.
8139549 1994 Identification of I-plastin, a human fimbrin isoform expressed in intestine and kidney.
7655078 1995 Sequential expression and differential localization of I-, L-, and T-fimbrin during differentiation of the mouse intestine and yolk sac.
3211125 1988 Molecular cloning and characterization of plastin, a human leukocyte protein expressed in transformed human fibroblasts.
2111166 1990 Characterization of interleukin 2 stimulated 65-kilodalton phosphoprotein in human T cells.