Property Summary

NCBI Gene PubMed Count 15
PubMed Score 223.64
PubTator Score 138.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 2.1e-04
ductal carcinoma in situ 1.700 1.2e-02
ependymoma -1.500 2.2e-09
glioblastoma -1.100 7.6e-04
interstitial cystitis -2.400 4.6e-02
intraductal papillary-mucinous adenoma (... 2.000 3.3e-03
intraductal papillary-mucinous carcinoma... 2.100 4.0e-03
intraductal papillary-mucinous neoplasm ... 3.400 2.2e-03
lung adenocarcinoma 1.064 3.6e-05
lung carcinoma 1.400 9.2e-13
nasopharyngeal carcinoma -1.400 9.9e-03
nephrosclerosis -1.117 3.6e-03
pancreatic cancer 1.700 2.8e-05
spina bifida -1.792 3.1e-02

Gene RIF (3)

AA Sequence

MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGK      1 - 70
ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSYSEEEKVAFVNWINKALENDP     71 - 140
DCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDERAINKKKLTPFTISENLNLALNSASAIGCTV    141 - 210
VNIGASDLKEGKPHLVLGLLWQIIKVGLFADIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHL    211 - 280
TNAGWHTISNFSQDIKDSRAYFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQF    281 - 350
VTPADVVSGNPKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEGESKEERTFRNWMNSLGVNPYINHLYSD    351 - 420
LADALVIFQLYEMIRVPVNWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLNEGNST    421 - 490
LTLALVWQLMRRYTLNVLSDLGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAI    491 - 560
APNAVRQEMIRRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK     561 - 629
//

Text Mined References (20)

PMID Year Title