Property Summary

NCBI Gene PubMed Count 13
PubMed Score 60.27
PubTator Score 25.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ductal carcinoma in situ -1.300 3.0e-03
fibroadenoma -2.000 1.9e-02
gastric carcinoma -1.900 3.7e-02
interstitial cystitis -1.500 5.3e-04
intraductal papillary-mucinous neoplasm ... -1.300 3.2e-02
invasive ductal carcinoma -1.100 2.1e-02
ovarian cancer 1.100 3.7e-07
pancreatic cancer -1.100 5.7e-04
pituitary cancer -1.200 2.0e-03
tuberculosis -1.100 9.2e-06

Gene RIF (10)

AA Sequence

MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLAENCVCGLTTR      1 - 70
ALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKDVVASSVTGVVDLARRGRRWS     71 - 140
VELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEAEGPEVGSVEDQRRQQGYFVRLGSLSARIRH    141 - 210
LAYEHSVGKLRQSKHRAQDTLAQLQETLELIDHMQCGVTPTAPACPGKVHELWGEWGQRPPESRRRSQAE    211 - 280
LETLVLSRSLTQELQGTVEALESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGR    281 - 350
VAHAHACVDELLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWE    351 - 420
AEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF                               421 - 463
//

Text Mined References (17)

PMID Year Title