Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.40
PubTator Score 0.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 1.2e-03
ependymoma -2.500 4.9e-08
glioblastoma -1.300 1.9e-02
group 4 medulloblastoma -1.600 1.3e-02
interstitial cystitis -2.100 6.5e-04
intraductal papillary-mucinous carcinoma... 1.200 6.6e-03
medulloblastoma, large-cell -2.600 4.7e-04
nasopharyngeal carcinoma -1.400 2.9e-07
osteosarcoma -3.687 8.4e-07
pediatric high grade glioma -2.400 3.7e-05
Pick disease -1.900 3.7e-03
progressive supranuclear palsy -2.500 2.0e-02
psoriasis -1.200 1.3e-22
subependymal giant cell astrocytoma -2.493 4.1e-02

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAETQVGVMEEK      1 - 70
VKLSNLKNVDSEGSLHRKYQELLKAIKGKDELISQLEAQLEKQKQMRAEEAKTVQEKAAKIKEWVTLKLA     71 - 140
KLEMENQHLKSHNQRLVEQVGSLQDALEAIQIAPSRKLLVPPYGAAEQDSVPSEPGIQPMGQDSGSQAQG    141 - 210
LKAAVLAPSPGALQSKDSVSEAASPLEDSSSSTVHSGETVEAKPLQPHLGRESPPHQPCMKLLTFRCSSA    211 - 280
SWGEGLVTAQRGMLPGTKTSAREGGPGSSLTLPKVRAPGTPRDSIQLAKRHHSQPQVGHGHFGRVVNIET    281 - 350
EAFSALHPSGLPELESRARSREEPEKMEMEEPPPAGKNEERESPKALGAELEEVELGNKPPTPPLHQFSS    351 - 420
WESRIYAVATSGMRLSDMSPRSNTACCASSPPALVSPGSFSGLVYKNVTVPVYTALKGRATQISNMPFMD    421 - 490
ESSGSDDDCSSQASFRISVPSSESRKTSGLGSPRAIKRGVSMSSLSSEGDYAIPPDACSLDSDYSEPEHK    491 - 560
LQRTSSYSTDGLGLGGESLEKSGYLLKMGSQVKTWKRRWFVLRQGQIMYYKSPSDVIRKPQGQVDLNSRC    561 - 630
QIVRGEGSQTFQLISEKKTYYLTADSPSLLEEWIRVLQSLLKVQATGPPALLRGGTKPTVKGWLTKVKHG    631 - 700
HSKVVWCALVGKIFYYYRSHEDKRPLGCLPVRDAHIEEVDRSCDSDEDYEAGGTRRLLSSHCTLVIHPTE    701 - 770
HSPTYLLIGTKHEKDTWLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYAS    771 - 840
LTTLPSEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMKQTSCRPP    841 - 910
QKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYATYCQRAVERTLRTGEREARPSRM    911 - 980
EVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTVDEFLQRLNQEIGMRKPSHSGFALFTDDPSGR    981 - 1050
DLEHCLQGSVKICDAISKWEQAMKELHPGKSEGGTRVVKLMYKNRLYFRSQVKGETDRERLLLASQTSRE   1051 - 1120
IVAGRFPINKELALEMAALMAQVEYGDLEKPALPGPGGTSPAKAQHLLQQVLDRFHPRRYRHGAPAEQLR   1121 - 1190
HLADMLTTKWATLQGCSPPECIRIYLTVARKWPFFGAKLFAAQPAQLSSKENALVWIAVNEDGVSILDHN   1191 - 1260
TMQVHITYPYSSVTTFGGCRDDFMLVIRSIPDKSSGKSHIEKLIFRMAAPKIAEATFIMASYMNHCTTTV   1261 - 1330
NPPTNPPGACQLWELDGRQFFSSVSCATKGPTLL                                       1331 - 1364
//

Text Mined References (6)

PMID Year Title