Property Summary

NCBI Gene PubMed Count 38
PubMed Score 743.74
PubTator Score 376.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 2.100 1.7e-02
breast carcinoma 1.100 3.1e-03
cutaneous lupus erythematosus 2.400 1.0e-03
diabetes mellitus -1.400 4.4e-02
glioblastoma 2.200 4.7e-03
head and neck cancer and chronic obstruc... 1.500 4.6e-03
interstitial cystitis 1.800 1.2e-02
invasive ductal carcinoma 1.598 2.2e-03
lung cancer -1.700 6.2e-03
lung carcinoma -2.800 2.0e-24
non-small cell lung cancer -1.085 4.5e-07
osteosarcoma -2.084 1.1e-02
ovarian cancer -1.400 1.3e-04
primary Sjogren syndrome 2.700 1.6e-04
psoriasis 1.200 2.2e-02
sarcoidosis 1.100 3.9e-02
subependymal giant cell astrocytoma 1.578 2.2e-02
ulcerative colitis 1.500 1.0e-02

Gene RIF (12)

AA Sequence

MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPCQDFGKRMFVFK      1 - 70
ITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGI     71 - 140
KELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFL    141 - 210
DNPDAFYYFPDSGFFCEENSSDDDVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDP    211 - 280
AGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAATPKERTEWIRAIQMASRTGK    281 - 350
//

Text Mined References (42)

PMID Year Title