Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.11
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
pancreatic cancer -1.100 2.3e-04
Waldenstrons macroglobulinemia 1.126 3.2e-02
astrocytic glioma -1.200 3.3e-02
esophageal adenocarcinoma 1.100 1.8e-02
psoriasis -1.800 7.5e-05
glioblastoma -2.100 9.7e-06
osteosarcoma -2.141 1.4e-04
ependymoma -1.100 4.5e-03
group 4 medulloblastoma 1.400 2.0e-02
atypical teratoid / rhabdoid tumor -2.600 6.2e-07
medulloblastoma, large-cell -1.300 6.2e-03
tuberculosis 1.100 2.0e-07
non-small cell lung cancer -1.061 1.9e-12
lung cancer -2.600 2.4e-04
colon cancer -1.800 1.9e-02
pediatric high grade glioma -1.500 3.8e-04
primary Sjogren syndrome 1.900 5.7e-05
pancreatic carcinoma -1.100 2.3e-04
subependymal giant cell astrocytoma -1.981 4.4e-02
invasive ductal carcinoma -1.200 5.1e-03
acute myeloid leukemia -1.200 2.1e-03
ulcerative colitis -1.300 1.5e-04
ovarian cancer -3.300 2.3e-12
dermatomyositis 1.400 6.9e-04

Gene RIF (3)

PMID Text
25880423 PLCL2 was identified as a new susceptibility gene for systemic sclerosis.
24916648 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese
19898481 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAECGRGGAAGGALPTSPGPALGAKGALKAGVGEGGGGGGRLGHGRARYDSGGVSNGDCSLGVSGDEARA      1 - 70
SPTRGPRGVALAPTPSAVVCTLPRESKPGGLPRRSSIIKDGTKQKRERKKTVSFSSMPTEKKISSASDCI     71 - 140
NSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISD    141 - 210
QISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLISYGKHTLDMLESSQDNMRTSWVSQMFSEID    211 - 280
VDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQ    281 - 350
FSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPE    351 - 420
HKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTM    421 - 490
TSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTTSPNVEESYLPSPDV    491 - 560
LKGKILIKAKKLSSNCSGVEGDVTDEDEGAEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQF    561 - 630
KEFQVSFQVQKYWEVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIV    631 - 700
AMNFQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPK    701 - 770
GSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDE    771 - 840
FIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRT    841 - 910
LWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNL    911 - 980
SEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKE    981 - 1050
RKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEK   1051 - 1120
ANDETGE                                                                  1121 - 1127
//

Text Mined References (23)

PMID Year Title
25880423 2015 Identification of NF-?B and PLCL2 as new susceptibility genes and highlights on a potential role of IRF8 through interferon signature modulation in systemic sclerosis.
24916648 2015 A genome-wide association study identifies PLCL2 and AP3D1-DOT1L-SF3A2 as new susceptibility loci for myocardial infarction in Japanese.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16754670 2006 Modulation of GABA(A) receptor phosphorylation and membrane trafficking by phospholipase C-related inactive protein/protein phosphatase 1 and 2A signaling complex underlying brain-derived neurotrophic factor-dependent regulation of GABAergic inhibition.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
10581172 1999 Identification and characterization of a new phospholipase C-like protein, PLC-L(2).
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.