Property Summary

Ligand Count 14
NCBI Gene PubMed Count 10
PubMed Score 2.04
PubTator Score 1.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.2e-03
psoriasis 6694 1.3e-03

Gene RIF (7)

AA Sequence

MKSPHVLVFLCLLVALVTGNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYG      1 - 70
RLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTP     71 - 140
PC                                                                        141 - 142
//

Text Mined References (10)

PMID Year Title