Property Summary

NCBI Gene PubMed Count 80
PubMed Score 116.25
PubTator Score 70.52

Knowledge Summary

Patent (23,344)

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.100 7.7e-04
osteosarcoma -1.563 5.5e-05
atypical teratoid / rhabdoid tumor 1.200 9.2e-06
glioblastoma 1.500 1.5e-05
pediatric high grade glioma 1.100 1.4e-04
ovarian cancer 1.500 1.3e-05

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (25)

PMID Text
26296974 TXA2-mediated neoplastic responses in prostate adenocarcinoma PC-3 cells occur through a PRK1/PRK2-dependent mechanism.
25504435 Transcriptome and interactome analyses uncover that PRK1 regulates expression of migration-relevant genes by interacting with the scaffold protein sperm-associated antigen 9 (SPAG9/JIP4).
24248594 Data indicate that Salmonella SspH1 catalyzes the ubiquitination and proteasome-dependent degradation of PKN1 in cells.
24114839 Protein kinase N1 inhibits Wnt/b-catenin signaling and apoptosis in melanoma cells.
22893700 Protein kinase N1 is a novel substrate of NFATc1-mediated cyclin D1-CDK6 activity and modulates vascular smooth muscle cell division and migration leading to inward blood vessel wall remodeling.
21754995 PKN isoforms are not simply redundant in supporting migration, but appear to be linked through isoform specific regulatory domain properties to selective upstream signals. It
21357687 PRK1 is a bona fide interactant of TPalpha/TPbeta, and leading to H3 Thr(11) phosphorylation to regulate cell migration
21351730 Data show that just one contact site as being relevant for binding of RhoA and domain from PRK1, and the HR1b domain was found not to contribute to RhoA binding.
21224381 A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in alpha1-adrenergic receptor-induced p38 activation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20188095 Protein kinase C-related kinase targets nuclear localization signals in a subset of class IIa histone deacetylases.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19427017 PRK1 is present in various malignancies, but especially in ovarian serous carcinomas
19214198 Application of HIV-1 Tat transmembrane transport peptide to cells induces PKN1 gene and slightly represses two genes, ZCD1 and BSG
18713748 Protein kinase C-related kinase and ROCK are required for thrombin-induced endothelial cell permeability downstream from Galpha12/13 and Galpha11/q
18519042 Deregulation of PKN1 may contribute to the pathogenic process in amyotrophic lateral sclerosis.
18429822 Study identifies TRAF1 as a substrate of PKN1 kinase activity in vitro and in vivo, and show that this phosphorylation event is required for attenuating downstream kinase activities.
17301291 Human pregnancy is characterized by increases in PKN1 expression in the myometrium.
16331689 Data strengthen the hypothesis that Cyclin T2a plays a role in muscle differentiation, and propose PKNalpha as a novel partner of Cyclin T2a in this process.
15791647 PKN1 mediates arsenite-induced delay of the G(2)/M transition by binding to and phosphorylating Cdc25C
15123640 Data suggest that hyaluronan-CD44 interaction with Rac1-protein kinase N gamma plays a pivotal role in phospholipase C gamma1-regulated calcium signaling and cortactin-cytoskeleton function required for keratinocyte cell-cell adhesion and differentiation.
14514689 analysis of the interaction between the small G proteins Rac1 and RhoA and protein kinase C-related kinase 1
12761180 PKNalpha functions as not only an upstream activator of MLTKalpha but also a putative scaffold protein for the p38gamma MAPK signaling pathway
12514133 Data show that stimulation of the RhoA effector protein kinase C-related kinase (PRK) signalling cascade results in a ligand-dependent superactivation of androgen receptors both in vivo and in vitro.

AA Sequence

MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSL      1 - 70
GPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTCSATNLSRVAGLEKQLAIELK     71 - 140
VKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQAGQLENQAAPDDTQGSPDLGA    141 - 210
VELRIEELRHHFRVEHAVAEGAKNVLRLLSAAKAPDRKAVSEAQEKLTESNQKLGLLREALERRLGELPA    211 - 280
DHPKGRLLREELAAASSAAFSTRLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPETIPWNPTPSMGG    281 - 350
PGTPDSRPPFLSRPARGLYSRSGSLSGRSSLKAEAENTSEVSTVLKLDNTVVGQTSWKPCGPNAWDQSFT    351 - 420
LELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFRNPVIERIPRLRRQ    421 - 490
KKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATGTGTFSPGASPGSEARTTGDISVEKLNLGTDSD    491 - 560
SSPQKSSRDPPSSPSSLSSPIQESTAPELPSETQETPGPALCSPLRKSPLTLEDFKFLAVLGRGHFGKVL    561 - 630
LSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAG    631 - 700
GDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGD    701 - 770
RTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSA    771 - 840
EAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTG    841 - 910
EAPTLSPPRDARPLTAAEQAAFLDFDFVAGGC                                          911 - 942
//

Text Mined References (95)

PMID Year Title
26296974 2015 Protein kinase C-related kinase 1 and 2 play an essential role in thromboxane-mediated neoplastic responses in prostate cancer.
25504435 2014 PRK1/PKN1 controls migration and metastasis of androgen-independent prostate cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24248594 2014 Structure of an SspH1-PKN1 complex reveals the basis for host substrate recognition and mechanism of activation for a bacterial E3 ubiquitin ligase.
24114839 2013 Protein kinase PKN1 represses Wnt/?-catenin signaling in human melanoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22893700 2012 Protein kinase N1 is a novel substrate of NFATc1-mediated cyclin D1-CDK6 activity and modulates vascular smooth muscle cell division and migration leading to inward blood vessel wall remodeling.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21754995 2011 Regulatory domain selectivity in the cell-type specific PKN-dependence of cell migration.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21357687 2011 Identification of an interaction between the TPalpha and TPbeta isoforms of the human thromboxane A2 receptor with protein kinase C-related kinase (PRK) 1: implications for prostate cancer.
21351730 2011 Mutational analysis reveals a single binding interface between RhoA and its effector, PRK1.
21269460 2011 Initial characterization of the human central proteome.
21224381 2011 A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in ?1-adrenergic receptor-induced p38 activation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20228790 2010 Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4.
20188095 2010 Protein kinase C-related kinase targets nuclear localization signals in a subset of class IIa histone deacetylases.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19427017 2009 PRK1 distribution in normal tissues and carcinomas: overexpression and activation in ovarian serous carcinoma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18713748 2008 Protein kinase C-related kinase and ROCK are required for thrombin-induced endothelial cell permeability downstream from Galpha12/13 and Galpha11/q.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519042 2008 Deregulation of PKN1 activity disrupts neurofilament organisation and axonal transport.
18429822 2008 Negative regulation of constitutive NF-kappaB and JNK signaling by PKN1-mediated phosphorylation of TRAF1.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18066052 2008 Phosphorylation of histone H3 at threonine 11 establishes a novel chromatin mark for transcriptional regulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006505 2008 The Rac1 polybasic region is required for interaction with its effector PRK1.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17332740 2007 Rho GTPases regulate PRK2/PKN2 to control entry into mitosis and exit from cytokinesis.
17301291 2007 Up-regulation of myometrial RHO effector proteins (PKN1 and DIAPH1) and CPI-17 (PPP1R14A) phosphorylation in human pregnancy is associated with increased GTP-RHOA in spontaneous preterm labor.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16611232 2006 A Salmonella type III secretion effector interacts with the mammalian serine/threonine protein kinase PKN1.
16331689 2006 Pkn is a novel partner of cyclin T2a in muscle differentiation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15791647 2005 Involvement of protein kinase PKN1 in G2/M delay caused by arsenite.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15123640 2004 Hyaluronan-CD44 interaction with Rac1-dependent protein kinase N-gamma promotes phospholipase Cgamma1 activation, Ca(2+) signaling, and cortactin-cytoskeleton function leading to keratinocyte adhesion and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14741690 2004 Protein kinase PKN1 associates with TRAF2 and is involved in TRAF2-NF-kappaB signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14514689 2003 Molecular dissection of the interaction between the small G proteins Rac1 and RhoA and protein kinase C-related kinase 1 (PRK1).
12761180 2003 Regulation of a mitogen-activated protein kinase kinase kinase, MLTK by PKN.
12514133 2003 A novel inducible transactivation domain in the androgen receptor: implications for PRK in prostate cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435421 2002 Aberrant glycosylation modulates phosphorylation of tau by protein kinase A and dephosphorylation of tau by protein phosphatase 2A and 5.
12387894 2002 Involvement of aberrant glycosylation in phosphorylation of tau by cdk5 and GSK-3beta.
11930178 2002 Nanomolar amyloid beta protein activates a specific PKC isoform mediating phosphorylation of MARCKS in Neuro2A cells.
11802708 2002 Pathological shear stress stimulates the tyrosine phosphorylation of alpha-actinin associated with the glycoprotein Ib-IX complex.
11432776 2001 PKNbeta interacts with the SH3 domains of Graf and a novel Graf related protein, Graf2, which are GTPase activating proteins for Rho family.
11259428 2001 PKN regulates phospholipase D1 through direct interaction.
11134534 2001 PKN delays mitotic timing by inhibition of Cdc25C: possible involvement of PKN in the regulation of cell division.
11104762 2001 Phosphorylation of tau is regulated by PKN.
11078882 2000 Further evidence that 3-phosphoinositide-dependent protein kinase-1 (PDK1) is required for the stability and phosphorylation of protein kinase C (PKC) isoforms.
11054541 2000 Cloning and characterization of AWP1, a novel protein that associates with serine/threonine kinase PRK1 in vivo.
10843871 2000 The Rho effector, PKN, regulates ANF gene transcription in cardiomyocytes through a serum response element.
10809724 2000 PKN binds and phosphorylates human papillomavirus E6 oncoprotein.
10792047 2000 Phosphorylation of protein kinase N by phosphoinositide-dependent protein kinase-1 mediates insulin signals to the actin cytoskeleton.
10764742 2000 A 3-phosphoinositide-dependent protein kinase-1 (PDK1) docking site is required for the phosphorylation of protein kinase Czeta (PKCzeta ) and PKC-related kinase 2 by PDK1.
10753910 2000 Rho GTPase control of protein kinase C-related protein kinase activation by 3-phosphoinositide-dependent protein kinase.
10640683 1999 Interaction of PKN with a neuron-specific basic helix-loop-helix transcription factor, NDRF/NeuroD2.
10619026 1999 The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.
10467162 1999 Mutational analysis of the regulatory mechanism of PKN: the regulatory region of PKN contains an arachidonic acid-sensitive autoinhibitory domain.
10388627 1999 Biochemical and crystallographic characterization of a Rho effector domain of the protein serine/threonine kinase N in a complex with RhoA.
10358086 1999 Characterization of a novel giant scaffolding protein, CG-NAP, that anchors multiple signaling enzymes to centrosome and the golgi apparatus.
9832145 1998 New phosphorylation sites identified in hyperphosphorylated tau (paired helical filament-tau) from Alzheimer's disease brain using nanoelectrospray mass spectrometry.
9751706 1998 Proteolytic activation of PKN by caspase-3 or related protease during apoptosis.
9637778 1998 PKN interacts with a paraneoplastic cerebellar degeneration-associated antigen, which is a potential transcription factor.
9570957 1998 The protein kinase N (PKN) gene PRKCL1/Prkcl1 maps to human chromosome 19p12-p13.1 and mouse chromosome 8 with close linkage to the myodystrophy (myd) mutation.
9546672 1998 Sequential phosphorylation of Tau by glycogen synthase kinase-3beta and protein kinase A at Thr212 and Ser214 generates the Alzheimer-specific epitope of antibody AT100 and requires a paired-helical-filament-like conformation.
9533029 1997 Detailed map of a region commonly amplified at 11q13-->q14 in human breast carcinoma.
9478917 1998 PRK1 is targeted to endosomes by the small GTPase, RhoB.
9446575 1998 Multiple interactions of PRK1 with RhoA. Functional assignment of the Hr1 repeat motif.
9199504 1997 Phosphorylation of microtubule-associated protein tau by stress-activated protein kinases.
9175763 1997 Domain-specific phosphorylation of vimentin and glial fibrillary acidic protein by PKN.
9030526 1997 Interaction of PKN with alpha-actinin.
8816775 1996 Translocation of PKN from the cytosol to the nucleus induced by stresses.
8621664 1996 PKN associates and phosphorylates the head-rod domain of neurofilament protein.
8571127 1996 Identification of a putative target for Rho as the serine-threonine kinase protein kinase N.
8571126 1996 Protein kinase N (PKN) and PKN-related protein rhophilin as targets of small GTPase Rho.
8557118 1996 PRK1 phosphorylates MARCKS at the PKC sites: serine 152, serine 156 and serine 163.
8135837 1994 A novel protein kinase with leucine zipper-like sequences: its catalytic domain is highly homologous to that of protein kinase C.
7988719 1994 Identification of multiple, novel, protein kinase C-related gene products.
7957185 1994 Identification and characterization of DBK, a novel putative serine/threonine protein kinase from human endothelial cells.
7851406 1995 Cloning and expression patterns of two members of a novel protein-kinase-C-related kinase family.