Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.56
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.700 5.9e-04
astrocytic glioma -1.500 3.8e-02
atypical teratoid / rhabdoid tumor -1.300 8.6e-04
glioblastoma -1.200 5.7e-05
medulloblastoma -1.200 1.0e-06
medulloblastoma, large-cell -1.400 3.2e-06
oligodendroglioma -1.600 4.2e-02
osteosarcoma -2.007 1.5e-04
pancreatic cancer -1.200 1.1e-03
pancreatic carcinoma -1.200 1.1e-03
Pick disease -1.200 1.6e-04

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MSHGHSHGGGGCRCAAEREEPPEQRGLAYGLYLRIDLERLQCLNESREGSGRGVFKPWEERTDRSKFVES      1 - 70
DADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTEREPDQTFSLNRDLTGELEYA     71 - 140
TKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELRRHEVTICNYEASANPADHRVHQVTPQTHFI    141 - 210
S//

Text Mined References (13)

PMID Year Title