Property Summary

NCBI Gene PubMed Count 20
PubMed Score 89.42
PubTator Score 19.72

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.600 5.2e-05
osteosarcoma -2.050 1.2e-07
atypical teratoid / rhabdoid tumor -1.500 1.5e-06
medulloblastoma, large-cell -1.100 2.2e-02
subependymal giant cell astrocytoma -1.570 1.3e-02
invasive ductal carcinoma -1.100 3.8e-02

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
17478478 High-throughput mass spectrometry screening for inhibitors of PISD is reported.

AA Sequence

MATSVGHRCLGLLHGVAPWRSSLHPCEITALSQSLQPLRKLPFRAFRTDARKIHTAPARTMFLLRPLPIL      1 - 70
LVTGGGYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLSRAWGRLNQVELPHWLRRPVY     71 - 140
SLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSVISPSDGRILNFGQVKNCEVEQVKG    141 - 210
VTYSLESFLGPRMCTEDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDWTVSHRRHF    211 - 280
PGSLMSVNPGMARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYN    281 - 350
DFSFVTHTNREGVPMRKGEHLGEFNLGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL               351 - 409
//

Text Mined References (21)

PMID Year Title
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19165886 2009 Phosphatidylserine decarboxylases, key enzymes of lipid metabolism.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17478478 2007 High-throughput mass spectrometry screening for inhibitors of phosphatidylserine decarboxylase.
16381901 2006 The LIFEdb database in 2006.
16192276 2005 Disruption of the phosphatidylserine decarboxylase gene in mice causes embryonic lethality and mitochondrial defects.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10591208 1999 The DNA sequence of human chromosome 22.
9110174 1997 Large-scale concatenation cDNA sequencing.
8870646 1996 Post-translational processing of the phosphatidylserine decarboxylase gene product in Chinese hamster ovary cells.
8619474 1996 A "double adaptor" method for improved shotgun library construction.