Property Summary

NCBI Gene PubMed Count 3
PubMed Score 49.36
PubTator Score 18.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.123 5.5e-04
posterior fossa group A ependymoma 4.000 1.5e-13
diabetes mellitus 1.200 1.1e-03
sonic hedgehog group medulloblastoma 2.200 1.2e-02
ovarian cancer 1.100 2.8e-09
psoriasis -1.500 1.5e-08

AA Sequence

MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMSVGGAILLFGV      1 - 70
VITCLAYTLKLSDKSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKHRQKSNFLRSLKSFFLTR        71 - 137
//

Text Mined References (4)

PMID Year Title
18455988 2008 Pirt, a phosphoinositide-binding protein, functions as a regulatory subunit of TRPV1.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11181995 2001 The sequence of the human genome.