Property Summary

Ligand Count 3
NCBI Gene PubMed Count 22
PubMed Score 7.47
PubTator Score 15.69

Knowledge Summary

Patent (2,536)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 2.9e-02
atypical teratoid / rhabdoid tumor -1.300 1.9e-04
glioblastoma -1.200 2.8e-03
group 4 medulloblastoma 1.700 5.3e-04
ovarian cancer -1.100 1.2e-13
posterior fossa group B ependymoma -1.100 2.6e-13

 GWAS Trait (1)

Protein-protein Interaction (2)

PDB (14)

Gene RIF (6)

AA Sequence

MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPDD      1 - 70
FKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFL     71 - 140
TTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLLPQFLGMYRLTVDGVETYMVVTRNVFSHRLT    141 - 210
VHRKYDLKGSTVAREASDKEKAKDLPTFKDNDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYS    211 - 280
LLVGIHDVDRAEQEEMEVEERAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYA    281 - 350
MKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT        351 - 416
//

Text Mined References (29)

PMID Year Title