Property Summary

NCBI Gene PubMed Count 55
PubMed Score 349.09
PubTator Score 940.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -3.600 2.9e-07
cutaneous lupus erythematosus -2.800 3.9e-02
diabetes mellitus 1.200 1.1e-03
cystic fibrosis -2.200 5.3e-05
inflammatory breast cancer -6.000 9.5e-03
breast carcinoma -1.100 3.8e-03
chronic rhinosinusitis 2.976 6.7e-03

Gene RIF (33)

PMID Text
26585492 In summary, this study suggests that PIP expression regulates the process of cell adhesion in breast cancer.
25919462 GCDFP15 in stratum corneum is a potential marker for dysregulated sweating in atopic dermatitis.
25472539 PIP is a breast cancer-related protein that is expressed in a majority of breast tumors and has a significant function in the biology of this disease. [review]
25425335 The commonly used breast carcinoma biomarkers vary in their prognostic implications. GCDFP-15 independently indicated a favourable prognosis. GATA-3 and MGB were not associated with outcome.
25405607 Data indicate the potential role of Gross cystic disease fluid protein-15/prolactin-inducible protein (GCDFP-15/PIP) as a biomarker for keratoconus (KC)disease.
25070172 GCDFP-15 expression is higher in tumors with favorable prognostic features. GCDFP-15 expression is further a frequent feature of androgen receptor positive tumors and the molecular apocrine subtype.
24862759 PIP is required for cell cycle progression in breast cancer and provides a rationale for exploring PIP inhibition as a therapeutic approach in breast cancer that can potentially target microtubule polymerization.
24272937 Report GCDFP15 expression in metastatic basal-like triple negative breast carcinomas.
24114735 AZGP1 and PIP were found in significantly lower levels in invasive breast tissue.
23755096 The roles of PIP in the related T47D breast cancer cell line, were investigated.
23663520 we found that HER2 or GCDFP15 protein overexpression is a sensitive and specific tool to differentiate MA from BL in the context of ER negative tumors.
23332923 GCDFP-15 was associated significantly with a breast cancer profile of good prognosis tumors.
23085372 Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma
23011826 GCDFP-15 alone is not a useful marker to detect the metastasis of basaloid type breast cancers.
22963676 Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer.
22817771 Prolactin-induced protein mediates cell invasion and regulates integrin signaling in estrogen receptor-negative breast cancer.
22724438 expression was down-regulated in azoospermia, indicating that PIP may be a plausible marker of azoospermia
22209935 The first report of native human serum albumin (HSA)-PIP complex formation in seminal plasma.
21883842 abnormal development of the prepuce in hypospadias is associated with variation in PIP expression
21809344 Data suggest that Runx2 controls a positive feedback loop between androgen signaling and PIP, and pharmacological inhibition of PIP may be useful to treat PIP positive tumors.
21411781 Most basal-like breast carcinomas and unclassified triple-negative carcinomas are negative for mammaglobin and gross cystic disease fluid protein 15.
19650845 Observational study of gene-disease association. (HuGE Navigator)
19620839 expressed on a small subset of primary lung adenocarcinomas
19262752 importance of a regulatory subnetwork associated with PIP expression in which STAT5 appears as a potential transcriptional regulator
19217055 Both MGB1 and GCDFP-15 are specific markers for metastatic breast carcinomas in cell block fluid specimens (88 vs. 96%).
18930737 analysis of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18251583 The sensitivity of mammaglobin is equal or superior to that of GCDFP-15 for investigation of breast carcinoma.
15632136 Forms a protein complex with PIG-F and is involved in the conversion of phosphatidylinositol glycans.
12755619 different conformations and/or tissue-specific posttranslational modifications of the proteins, although their primary structure was identical by MS/MS analysis
11992405 Intragenic amplification and formation of extrachromosomal small circular DNA molecules from the PIP gene on chromosome 7 in primary breast carcinomas
10713110 PIP(alternate name GCDFP-15, gp17) is a secretory marker of apocrine differentiation in breast carcinoma. It is an aspartyl proteinase with specificity restricted for fibronectin.
10072505 Gross cystic disease fluid protein-15 (GCDFP-15) binds to CD4, a T-cell co-receptor involved in antigen recognition, thereby inhibiting the ability of the receptor to interact with the HIV-1 envelope protein gp120
9724097 Gross cystic disease fluid protein-15 (GCDFP-15) binds to CD4, a T-cell co-receptor involved in antigen recognition, thereby inhibiting the ability of the receptor to interact with the HIV-1 envelope protein gp120

AA Sequence

MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT      1 - 70
YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI     71 - 140
EILKVE                                                                    141 - 146
//

Text Mined References (59)

PMID Year Title
26585492 2015 Prolactin-Induced Protein regulates cell adhesion in breast cancer.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25919462 2015 Gross cystic disease fluid protein 15 in stratum corneum is a potential marker of decreased eccrine sweating for atopic dermatitis.
25472539 2015 Prolactin-induced protein in breast cancer.
25425335 2015 GATA-binding protein 3, gross cystic disease fluid protein-15 and mammaglobin have distinct prognostic implications in different invasive breast carcinoma subgroups.
25405607 2014 Gross cystic disease fluid protein-15/prolactin-inducible protein as a biomarker for keratoconus disease.
25070172 2014 Gross cystic disease fluid protein 15 (GCDFP-15) expression in breast cancer subtypes.
24862759 2014 Prolactin-induced protein is required for cell cycle progression in breast cancer.
24272937 2014 Are mammaglobin and GCDFP-15 sensitive markers for diagnosis of metastatic basal-like triple negative breast carcinomas?
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
24114735 2014 Additive effect of the AZGP1, PIP, S100A8 and UBE2C molecular biomarkers improves outcome prediction in breast carcinoma.
23755096 2014 Prolactin-induced protein (PIP) regulates proliferation of luminal A type breast cancer cells in an estrogen-independent manner.
23663520 2013 Molecular apocrine breast cancers are aggressive estrogen receptor negative tumors overexpressing either HER2 or GCDFP15.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23332923 2013 Expression of mammaglobin and gross cystic disease fluid protein-15 in breast carcinomas.
23085372 2013 Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma.
23011826 2012 [Immunohistochemical characteristics of triple negative/basal-like breast cancer].
22963676 2013 Gross cystic disease fluid protein-15 and mammaglobin A expression determined by immunohistochemistry is of limited utility in triple-negative breast cancer.
22817771 2012 Prolactin-induced protein mediates cell invasion and regulates integrin signaling in estrogen receptor-negative breast cancer.
22724438 2012 Quantification studies in human seminal plasma samples identify prolactin inducible protein as a plausible marker of azoospermia.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22209935 2012 Human serum albumin as a new interacting partner of prolactin inducible protein in human seminal plasma.
21883842 2012 Association of prolactin-induced protein with preputial development of hypospadias.
21809344 2012 Runx2 controls a feed-forward loop between androgen and prolactin-induced protein (PIP) in stimulating T47D cell proliferation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21411781 2011 Relationship between molecular subtype of invasive breast carcinoma and expression of gross cystic disease fluid protein 15 and mammaglobin.
19650845 2010 CLC- a novel susceptibility gene for allergic rhinitis?
19620839 2009 GCDFP-15 positive and TTF-1 negative primary lung neoplasms: a tissue microarray study of 381 primary lung tumors.
19262752 2009 A functional and regulatory network associated with PIP expression in human breast cancer.
19217055 2009 Diagnostic utility of mammaglobin and GCDFP-15 in the identification of metastatic breast carcinoma in fluid specimens.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18930737 2008 Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
18251583 2008 Analysis of expression patterns of breast cancer-specific markers (mammaglobin and gross cystic disease fluid protein 15) in lung and pleural tumors.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16949771 2006 Origin and evolution of gene for prolactin-induced protein.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638438 2003 Human seminal plasma prolactin-inducible protein is an immunoglobulin G-binding protein.
12755619 2003 Structural study of GCDFP-15/gp17 in disease versus physiological conditions using a proteomic approach.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11133986 2001 AKT induces transcriptional activity of PU.1 through phosphorylation-mediated modifications within its transactivation domain.
10820003 2000 Mapping the CD4 binding domain of gp17, a glycoprotein secreted from seminal vesicles and breast carcinomas.
10713110 2000 A novel aspartyl proteinase from apocrine epithelia and breast tumors.
10072505 1999 Potent inhibition of CD4/TCR-mediated T cell apoptosis by a CD4-binding glycoprotein secreted from breast tumor and seminal vesicle cells.
9218538 1997 Isolation from a human seminal vesicle library of the cDNA for gp17, a CD4 binding factor.
9074931 1997 2006 expressed-sequence tags derived from human chromosome 7-enriched cDNA libraries.
3667631 1987 Isolation and sequencing of a cDNA clone for a prolactin-inducible protein (PIP). Regulation of PIP gene expression in the human breast cancer cell line, T-47D.
2727805 1989 The gene for prolactin-inducible protein (PIP), uniquely expressed in exocrine organs, maps to chromosome 7.
2013294 1991 Primary structure of a new actin-binding protein from human seminal plasma.
1955075 1991 The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation.