Property Summary

NCBI Gene PubMed Count 43
PubMed Score 178.18
PubTator Score 118.81

Knowledge Summary

Patent (13,601)

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer 1.400 1.3e-02
cutaneous lupus erythematosus 2.000 2.2e-02
psoriasis -1.200 6.3e-03
osteosarcoma -3.145 2.4e-08
periodontitis 1.300 8.4e-25
lung cancer -1.900 2.4e-04
interstitial cystitis 2.500 3.2e-05
lung adenocarcinoma 1.200 3.5e-08
pancreatic carcinoma 1.400 1.3e-02
ulcerative colitis 2.100 2.1e-05

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (36)

PMID Text
26643319 PIM2 gene knockdown enhances the anti-proliferative effect of AZD1208 in non-Hodgkin lymphoma cell line.
26551340 A high percentage of urothelial carcinomas express Pim kinases. Pim expression differs in NILG, NIHG, and IHG lesions.
26500282 We show that Pim2 inhibitors and proteasome inhibitors, such as bortezomib, have additive effects to inhibit the growth of myeloma cells, suggesting that Pim2 could be an interesting target for the treatment of multiple myeloma.
26078709 Our findings suggest that Pim-2-mediated aerobic glycolysis is critical for monitoring Warburg effect in colorectal tumor cells, highlighting Pim-2 as a potential metabolic target for colorectal tumor therapy.
26064888 our findings will help to uncover novel signaling pathways between inflammations and oxidative stress in rheumatoid arthritis development and imply that Pim-2/mTORC1 pathway may be critical for the initiation of inflammatory reactions.
25854938 Persistent activation of STAT3 by PIM2-driven positive feedback loop for epithelial-mesenchymal transition in breast cancer.
25238262 Data demonstrate the role of PIM kinases in driving myeloid leukemia, and as candidate molecules for therapy against human malignancies.
24799066 Blocking the activities of PIM kinases(PIM1, PIM2 and PIM3) could prevent pancreatic cancer development. PIM kinases(PIM1, PIM2 and PIM3) may be a novel target for cancer therapy
24505470 HIF-1A induced PIM2 expression in HepG2 cells via binding to the hypoxia-responsive elements (HREs) of the PIM2 promoter.
24142698 PIM2 could directly phosphorylate PKM2 on the Thr-454 residue, resulting in an increase of PKM2 protein levels. Compared with wild type, PKM2 with the phosphorylation-defective mutation displayed a reduced effect on glycolysis.
23898208 HIV-1 Tat upregulates expression of pim-2 oncogene (PIM2) in human primary T cells
23818547 Pim2 directly phosphorylates TSC2 on Ser-1798 and relieves the suppression of TSC2 on mTOR-C1, leading to multiple myeloma cells proliferation.
23813671 Overexpression of pim-2 may inhibit the apoptosis of prostate cancer cells through phosphorylation of eIF4B, thus promoting tumorigenesis.
23760264 Data indicate that PIM-2 is an upstream activator of E2F-1 and ATM in the ultraviolet damage response.
23752607 Our data indicate that PIM-2 and NF-kappaB gene expression is increased in patients with acute myeloid leukemia and acute lymphoblastic leukemia. High PIM-2 expression is associated with complete remission rate in AML patients.
23749639 our results identify eIF4B as a critical substrate of Pim kinases in mediating the activity of Abl oncogenes
23209281 PIM kinases promote the production of IFNgamma, the hallmark cytokine produced by Th1 cells.
22506047 While PIM-2 can function as a potent survival factor, it can, under certain circumstances, exhibit pro-apoptotic effects as well.
21859846 Targeting cap-dependent translation blocks converging survival signals by AKT and PIM 1, 2 kinases in lymphoma
21475253 IL-6 and TNF family cytokines upregulate Pim-2 in bone marrow stromal cells and osteoclasts in multiple myeloma. This appears to be a novel anti-apoptotic mechanism for MM cell survival.
21299464 Pax-5 may act as a transcription factor to modulate the expression of Pim-2 in B-cells
20939820 A cell-based test system useful for rapid and inexpensive pre-screening of compounds capable of preventing Pim-mediated phosphorylation is discussed.
20592892 Data show that Pim-2 can induce malignant transformation of human liver cell line L02.
20465571 PIM2 controls the expression of the pro-inflammatory cytokine IL-6.
19841674 structural analysis of the PIM2 kinase in complex with an organoruthenium inhibitor
19821157 we infer that Pim-2 could activate API-5 to inhibit the apoptosis of liver cells, and NF-kappaB is the key regulator
18675992 pim-2 acts as a pro-survival kinase to inhibit apoptosis and keep liver cell survival in IL-3-deprived medium. Pim-2 might participate in the tumorigenesis of hepatocellular carcinoma induction through its downstream molecules 4E-BP1 and Bad.
18593906 Pim kinases promote cell cycle progression and tumorigenesis by down-regulating p27(Kip1) expression at both transcriptional and posttranslational levels.
18424697 Foxp3 can regulate pim 2 expression.
18216297 expression of the Myc and Pim proto-oncogenes by Jak2V617F was found to be FERM domain dependent.
16403219 All three Pim kinase family members predominantly phosphorylate Bad on Ser112 and in addition are capable of phosphorylating Bad on multiple sites associated with the inhibition of the pro-apoptotic function of Bad in HEK-293 cells
16015593 Up-regulation of Pim-2 is associated with disease progression and perineural invasion in prostate cancer.
15721354 EBV-induced upregulation of Pim kinases and Pim-stimulated EBNA2 transcriptional activity may contribute to the ability of EBV to immortalize B-cells and predispose them to malignant growth.
15548703 transcriptional induction of Pim-2 initiates a novel NF-kappaB activation pathway that regulates cell survival
15291354 hPim-2 mRNA expression in NHL was 1.5 to 2.6 times higher in involved splenic foci compared to nearby uninvolved regions. hPim-2 mRNA was increased 3-folds in B-CLL over normal B-cells
12954615 pim-2 functions similarly to pim-1 as a pro-survival kinase; BAD is a legitimate PIM-2 substrate

AA Sequence

MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLG      1 - 70
WSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPS     71 - 140
RCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS    141 - 210
RHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEI    211 - 280
LLDPWMQTPAEDVPLNPSKGGPAPLAWSLLP                                           281 - 311
//

Text Mined References (46)

PMID Year Title
26643319 2015 Loss of PIM2 enhances the anti-proliferative effect of the pan-PIM kinase inhibitor AZD1208 in non-Hodgkin lymphomas.
26551340 Patterns and Significance of PIM Kinases in Urothelial Carcinoma.
26500282 2015 Control of Pim2 kinase stability and expression in transformed human haematopoietic cells.
26078709 2015 Pim-2 Modulates Aerobic Glycolysis and Energy Production during the Development of Colorectal Tumors.
26064888 2015 Pim-2/mTORC1 Pathway Shapes Inflammatory Capacity in Rheumatoid Arthritis Synovial Cells Exposed to Lipid Peroxidations.
25854938 2015 Persistent activation of STAT3 by PIM2-driven positive feedback loop for epithelial-mesenchymal transition in breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25238262 2014 The PIM family of oncoproteins: small kinases with huge implications in myeloid leukemogenesis and as therapeutic targets.
24799066 2014 PIM kinases: an overview in tumors and recent advances in pancreatic cancer.
24505470 2014 A regulatory feedback loop between HIF-1? and PIM2 in HepG2 cells.
24142698 2013 Proviral insertion in murine lymphomas 2 (PIM2) oncogene phosphorylates pyruvate kinase M2 (PKM2) and promotes glycolysis in cancer cells.
23818547 2013 Pim2 is required for maintaining multiple myeloma cell growth through modulating TSC2 phosphorylation.
23813671 2013 The over-expression of Pim-2 promote the tumorigenesis of prostatic carcinoma through phosphorylating eIF4B.
23760264 2013 The PIM-2 kinase is an essential component of the ultraviolet damage response that acts upstream to E2F-1 and ATM.
23752607 2013 Expression of PIM-2 and NF-?B genes is increased in patients with acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL) and is associated with complete remission rate and overall survival.
23749639 2013 eIF4B phosphorylation by pim kinases plays a critical role in cellular transformation by Abl oncogenes.
23209281 2013 Proviral integration site for Moloney murine leukemia virus (PIM) kinases promote human T helper 1 cell differentiation.
22506047 2012 Activation of cell cycle arrest and apoptosis by the proto-oncogene Pim-2.
21859846 2011 Targeting cap-dependent translation blocks converging survival signals by AKT and PIM kinases in lymphoma.
21475253 2011 The serine/threonine kinase Pim-2 is a novel anti-apoptotic mediator in myeloma cells.
21299464 2011 Paired box gene 5 may modulate Proviral Integration of Moloney virus 2 gene and protein expression in mature B-cells.
20939820 2010 Fighting tumor cell survival: advances in the design and evaluation of Pim inhibitors.
20592892 2010 Ectopic over-expression of oncogene Pim-2 induce malignant transformation of nontumorous human liver cell line L02.
20465571 2010 Proviral integration site 2 is required for interleukin-6 expression induced by interleukin-1, tumour necrosis factor-? and lipopolysaccharide.
20307683 2010 Pim-2 phosphorylation of p21(Cip1/WAF1) enhances its stability and inhibits cell proliferation in HCT116 cells.
19841674 2009 Crystal structure of the PIM2 kinase in complex with an organoruthenium inhibitor.
19821157 2010 Pim-2 activates API-5 to inhibit the apoptosis of hepatocellular carcinoma cells through NF-kappaB pathway.
18675992 2009 Serine/threonine kinase Pim-2 promotes liver tumorigenesis induction through mediating survival and preventing apoptosis of liver cell.
18593906 2008 Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels.
18424697 2008 Cutting edge: Foxp3-mediated induction of pim 2 allows human T regulatory cells to preferentially expand in rapamycin.
18216297 2008 The Jak2V617F oncogene associated with myeloproliferative diseases requires a functional FERM domain for transformation and for expression of the Myc and Pim proto-oncogenes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16548883 2006 Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.
16403219 2006 Pim kinases phosphorylate multiple sites on Bad and promote 14-3-3 binding and dissociation from Bcl-XL.
16015593 2005 Pim-2 upregulation: biological implications associated with disease progression and perinueral invasion in prostate cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15721354 2005 Pim kinases are upregulated during Epstein-Barr virus infection and enhance EBNA2 activity.
15548703 2004 Lymphocyte transformation by Pim-2 is dependent on nuclear factor-kappaB activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15291354 2004 Increased expression of the hPim-2 gene in human chronic lymphocytic leukemia and non-Hodgkin lymphoma.
15199164 2004 Mice deficient for all PIM kinases display reduced body size and impaired responses to hematopoietic growth factors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12954615 2003 The PIM-2 kinase phosphorylates BAD on serine 112 and reverses BAD-induced cell death.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9804974 1998 The human Pim-2 proto-oncogene and its testicular expression.