Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.00
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.2e-10
Disease Target Count Z-score Confidence
Paroxysmal nocturnal hemoglobinuria 10 3.667 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.300 1.2e-10

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MEDERSFSDICGGRLALQRRYYSPSCREFCLSCPRLSLRSLTAVTCTVWLAAYGLFTLCENSMILSAAIF      1 - 70
ITLLGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCIL     71 - 140
LKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP                          141 - 188
//

Text Mined References (13)

PMID Year Title