Property Summary

NCBI Gene PubMed Count 36
PubMed Score 688.49
PubTator Score 15.72

Knowledge Summary

Patent (448)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.252 8.4e-04
colon cancer -1.700 5.5e-04
lung cancer -1.100 2.0e-02
ovarian cancer 1.100 1.0e-04

Protein-protein Interaction (7)

Gene RIF (21)

PMID Text
26143926 Here two crystal structures are presented: the structure of human PIK42A and the structure of PIK42B containing a nucleoside analogue.
26038556 PI4KIIalpha is a specific downstream effector of GABARAP and it generates PI4P, which has a key role in the final stage of autophagy.
25940347 Rab27a is required for plasma membrane delivery of PI4K2A and HIV-1 Gag assembly in Jurkat cells
25083612 PI4K2A is a novel regulator of vesicular trafficking and neurotransmission in the brain.
25002402 phosphatidylinositol 4-kinase IIalpha knockdown inhibited vesicle-associated membrane protein 3 trafficking to perinuclear membranes and impaired the rate of VAMP3-mediated recycling of the transferrin receptor
24752359 structure and phylogenetic analysis
24675427 The palmitoylation insertion contributes to the phosphatidylinositol-binding pocket and anchors PI4KIIalpha to the membrane.
23676666 The Hermansky-Pudlak syndrome complex BLOC-1 and its cargo PI4KIIalpha interact with regulators of the actin cytoskeleton.
21218173 Knockdown of PI4KIIalpha inhibits EGF-stimulated Akt phosphorylation.
21190509 Results suggest that the phosphatidylinositol 4-kinase 2-alpha gene may not be a cause of autosomal recessive hereditary spastic paraplegia in humans.
20154717 PI4KIIalpha is a novel regulator of tumor growth by its action on angiogenesis and HIF-1alpha regulation.
19561074 Dvl directly interacted with and activated PI4KII alpha by increasing its V(max) for ATP and PtdIns. In addition, Dvl regulated PI4KII alpha and PIP5KI via different domains.
19010779 AP-3 and BLOC-1 act, either in concert or sequentially, to specify sorting of PI4KIIalpha along the endocytic route.
18256276 both the kinase activity and the sorting signal present in PI4KIIalpha are necessary to rescue endosomal PI4KIIalpha siRNA-induced mutant phenotypes
16443754 phosphatidylinositol 4-kinase IIalpha is necessary for the correct endocytic traffic and downregulation of activated epidermal growth factor receptor.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16249177 changes in membrane environment can regulate PI4KIIalpha activity.
15711748 The linkage of CD63 with PI 4-kinase type II may result in the recruitment of this signaling enzyme to specific membrane locations in the platelet where it influences phosphoinositide-dependent signaling and platelet spreading.
12914695 propose that PI4KIIalpha establishes the Golgi's unique lipid-defined organelle identity by generating PI(4)P-rich domains that specify the docking of the AP-1 coat machinery
12650639 The active site of this enzyme occurs in a p97/valosin-containing-protein-rich fraction of the endoplasmic reticulum
12594831 Association of T cell antigen CD7 with type II phosphatidylinositol-4 kinase, a key component in pathways of inositol phosphate turnover.

AA Sequence

MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAA      1 - 70
QGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFV     71 - 140
KDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPR    141 - 210
TKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAE    211 - 280
PLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLA    281 - 350
FPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQI    351 - 420
AVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW               421 - 479
//

Text Mined References (51)

PMID Year Title
26143926 2015 The high-resolution crystal structure of phosphatidylinositol 4-kinase II? and the crystal structure of phosphatidylinositol 4-kinase II? containing a nucleoside analogue provide a structural basis for isoform-specific inhibitor design.
26038556 2015 GABARAPs regulate PI4P-dependent autophagosome:lysosome fusion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25168678 2014 The crystal structure of the phosphatidylinositol 4-kinase II?.
25083612 2014 PI4KII? phosphorylation by GSK3 directs vesicular trafficking to lysosomes.
25002402 2014 Endosomal sorting of VAMP3 is regulated by PI4K2A.
24752359 2014 Puzzle out the regulation mechanism of PI4KII? activity.
24675427 2014 Molecular insights into the membrane-associated phosphatidylinositol 4-kinase II?.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23676666 2013 The WASH complex, an endosomal Arp2/3 activator, interacts with the Hermansky-Pudlak syndrome complex BLOC-1 and its cargo phosphatidylinositol-4-kinase type II?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23146885 2012 Phosphatidylinositol 4-kinase II? function at endosomes is regulated by the ubiquitin ligase Itch.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22535966 2012 Phosphatidylinositol 4-kinase II? is palmitoylated by Golgi-localized palmitoyltransferases in cholesterol-dependent manner.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21998198 2011 The schizophrenia susceptibility factor dysbindin and its associated complex sort cargoes from cell bodies to the synapse.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21218173 2010 Differential effects of the phosphatidylinositol 4-kinases, PI4KII? and PI4KIII?, on Akt activation and apoptosis.
21190509 2011 Screening for mutations in the phosphatidylinositol 4-kinase 2-alpha gene in autosomal recessive hereditary spastic paraplegia.
20388919 2010 Relationship between phosphatidylinositol 4-phosphate synthesis, membrane organization, and lateral diffusion of PI4KIIalpha at the trans-Golgi network.
20154717 2010 PI4KIIalpha is a novel regulator of tumor growth by its action on angiogenesis and HIF-1alpha regulation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19561074 2009 Regulation of phosphatidylinositol kinases and metabolism by Wnt3a and Dvl.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19010779 2009 Hermansky-Pudlak syndrome protein complexes associate with phosphatidylinositol 4-kinase type II alpha in neuronal and non-neuronal cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18256276 2008 Phosphatidylinositol-4-kinase type II alpha contains an AP-3-sorting motif and a kinase domain that are both required for endosome traffic.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897319 2007 Integral and associated lysosomal membrane proteins.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16443754 2006 Phosphatidylinositol 4-kinase is required for endosomal trafficking and degradation of the EGF receptor.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16249177 2006 Lipid and peptide control of phosphatidylinositol 4-kinase IIalpha activity on Golgi-endosomal Rafts.
15711748 2005 CD63 modulates spreading and tyrosine phosphorylation of platelets on immobilized fibrinogen.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12914695 2003 Phosphatidylinositol 4 phosphate regulates targeting of clathrin adaptor AP-1 complexes to the Golgi.
12650639 2003 Localization of a highly active pool of type II phosphatidylinositol 4-kinase in a p97/valosin-containing-protein-rich fraction of the endoplasmic reticulum.
12594831 2003 Association of T cell antigen CD7 with type II phosphatidylinositol-4 kinase, a key component in pathways of inositol phosphate turnover.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12324459 2002 Type II phosphatidylinositol 4-kinase beta is a cytosolic and peripheral membrane protein that is recruited to the plasma membrane and activated by Rac-GTP.
11279162 2001 Cloning of a human type II phosphatidylinositol 4-kinase reveals a novel lipid kinase family.
11244087 2001 A novel family of phosphatidylinositol 4-kinases conserved from yeast to humans.
11113129 2001 Evaluation of prototype transmembrane 4 superfamily protein complexes and their relation to lipid rafts.
9110174 1997 Large-scale concatenation cDNA sequencing.
9006891 1997 A novel link between integrins, transmembrane-4 superfamily proteins (CD63 and CD81), and phosphatidylinositol 4-kinase.
8619474 1996 A "double adaptor" method for improved shotgun library construction.