Property Summary

NCBI Gene PubMed Count 8
PubMed Score 27.43
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q8TCD6 B2RC30 D3DPC7
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLGDKGVREHEMKRAVT      1 - 70
SLPFTPGMVELFNFIRKNKDKFDCIIISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTVENYH     71 - 140
THSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVYIGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSR    141 - 210
MSQNLEPMEYSVVVWSSGVDIISHLQFLIKD                                           211 - 241
//

Text Mined References (9)

PMID Year Title