Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.63
PubTator Score 9.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Glioma 66
Disease Target Count P-value
osteosarcoma 7933 8.3e-07
psoriasis 6685 6.9e-04
ductal carcinoma in situ 1745 7.9e-04
invasive ductal carcinoma 2950 2.5e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Malignant glioma 23 4.287 2.1
Brain cancer 24 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.200 6.9e-04
osteosarcoma 2.098 8.3e-07
ductal carcinoma in situ -1.300 7.9e-04
invasive ductal carcinoma -1.300 2.5e-03

Gene RIF (11)

PMID Text
26610392 Functional analysis of the 11q23.3 glioma susceptibility locus implicates PHLDB1 and DDX6 in glioma susceptibility.
26156397 results suggest a significant association between the RETL1, TREH, and PHLDB1 genes and GBM development in the Han Chinese population
24982445 Liprin-alpha1, ERC1a and LL5 also define new highly polarized and dynamic cytoplasmic structures uniquely localized near the protruding cell edge
24935770 PHLDB1 rs498872 polymorphism was associated with increased risk of glioma.
24001599 study discovered multiple susceptibility variants for systemic lupus erythematosus in the 11q23.3 region, including variants in/near PHLDB1 (rs11603023), DDX6 (rs638893) and CXCR5 (rs10892301)
23300798 Single nucleotide polymorphisms in the PHLDB1 and ARCN1 genes are associated with increased risk of Glioma.
21350045 SUSCEPTIBILITY LOCI FOR GLIOMA AND GLIOBLASTOMA RISK IN A CHINESE POPULATION INCLUDED PHLDBI
20847058 Observational study of gene-disease association. (HuGE Navigator)
20513769 Signaling from laminin-integrin associations in epithelial cells attaches microtubule plus ends to the epithelial basal cell cortex via PHLDB1 and PHLDB2.
20462933 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19578367 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MDALNRNQIGPGCQTQTMVQKGPLDLIETGKGLKVQTDKPHLVSLGSGRLSTAITLLPLEEGRTVIGSAA      1 - 70
RDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVRQPTRLTQGCMLCLGQSTFLRFNHPAEAKW     71 - 140
MKSMIPAGGRAPGPPYSPVPAESESLVNGNHTPQTATRGPSACASHSSLVSSIEKDLQEIMDSLVLEEPG    141 - 210
AAGKKPAATSPLSPMANGGRYLLSPPTSPGAMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPGPS    211 - 280
VPPLVPARSSSYHLALQPPQSRPSGARSESPRLSRKGGHERPPSPGLRGLLTDSPAATVLAEARRATESP    281 - 350
RLGGQLPVVAISLSEYPASGALSQPTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFREPPGSERVLTTSP    351 - 420
SRQLVGRTFSDGLATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPLPTRTTPDPKLNREVAESP    421 - 490
RPRRWAAHGASPEDFSLTLGARGRRTRSPSPTLGESLAPHKGSFSGRLSPAYSLGSLTGASPCQSPCVQR    491 - 560
KLSSGDLRVPVTRERKNSITEISDNEDDLLEYHRRQRQERLREQEMERLERQRLETILNLCAEYSRADGG    561 - 630
PEAGELPSIGEATAALALAGRRPSRGLAGASGRSSEEPGVATQRLWESMERSDEENLKEECSSTESTQQE    631 - 700
HEDAPSTKLQGEVLALEEERAQVLGHVEQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQ    701 - 770
KAVDQLQEKLVALETGIQKERDKEAEALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSKAELLRS    771 - 840
IAKRKERLAILDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTVLERRYHSLTGGRPFPKTTSTL    841 - 910
KEMEKLLLPAVDLEQWYQELMAGLGTGPAAASPHSSPPPLPAKASRQLQVYRSKMDGEATSPLPRTRSGP    911 - 980
LPSSSGSSSSSSQLSVATLGRSPSPKSALLTQNGTGSLPRNLAATLQDIETKRQLALQQKGQQVIEEQRR    981 - 1050
RLAELKQKAAAEAQCQWDALHGAAPFPAGPSGFPPLMHHSILHHLPAGRERGEEGEHAYDTLSLESSDSM   1051 - 1120
ETSISTGGNSACSPDNMSSASGLDMGKIEEMEKMLKEAHAEKNRLMESREREMELRRQALEEERRRREQV   1121 - 1190
ERRLQSESARRQQLVEKEVKMREKQFSQARPLTRYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCR   1191 - 1260
GYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAKKRFFRFTMVT   1261 - 1330
ESPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFMN                          1331 - 1377
//

Text Mined References (32)

PMID Year Title
26610392 2015 Functional analysis of the 11q23.3 glioma susceptibility locus implicates PHLDB1 and DDX6 in glioma susceptibility.
26156397 2015 Association between RTEL1, PHLDB1, and TREH Polymorphisms and Glioblastoma Risk: A Case-Control Study.
24982445 2014 Liprin-?1, ERC1 and LL5 define polarized and dynamic structures that are implicated in cell migration.
24935770 2015 The PHLDB1 rs498872 (11q23.3) polymorphism and glioma risk: A meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24001599 2014 Three SNPs in chromosome 11q23.3 are independently associated with systemic lupus erythematosus in Asians.
23940118 2013 Epiblast integrity requires CLASP and Dystroglycan-mediated microtubule anchoring to the basal cortex.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23300798 2012 Fine mapping of a region of chromosome 11q23.3 reveals independent locus associated with risk of glioma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
21531791 2011 Chromosome 7p11.2 (EGFR) variation influences glioma risk.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21350045 2011 Association of sequence variants on chromosomes 20, 11, and 5 (20q13.33, 11q23.3, and 5p15.33) with glioma susceptibility in a Chinese population.
20847058 2010 Genetic risk profiles identify different molecular etiologies for glioma.
20513769 2010 Laminin-based cell adhesion anchors microtubule plus ends to the epithelial cell basal cortex through LL5alpha/beta.
20462933 2010 Interaction between 5 genetic variants and allergy in glioma risk.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19578367 2009 Genome-wide association study identifies five susceptibility loci for glioma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15491607 2004 Alternative splice variants encoding unstable protein domains exist in the human brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532993 2003 Identification and characterization of human LL5A gene and mouse Ll5a gene in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11001876 2000 Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.