Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.65
PubTator Score 4.63

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 8.7e-11
malignant mesothelioma 3163 4.8e-05
psoriasis 6685 2.4e-04


  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 4.8e-05
psoriasis -1.300 2.4e-04
osteosarcoma -3.518 8.7e-11


Accession Q9BWX1 K4DI82
Symbols HSPC045


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

22894908 PHF7 promoter binds H4K12ac in mature spermatozoa.

AA Sequence

LLEKPESSRGRRSYSWRSKGVRITNSCKKSK                                           351 - 381

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22894908 2012 Genome wide identification of promoter binding sites for H4K12ac in human sperm and its relevance for early embryonic development.
22595675 2012 Phf7 controls male sex determination in the Drosophila germline.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21630459 2011 Proteomic characterization of the human sperm nucleus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11829468 2002 NYD-SP6, a novel gene potentially involved in regulating testicular development/spermatogenesis.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7701562 1995 The PHD finger: implications for chromatin-mediated transcriptional regulation.