Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.38
PubTator Score 9.24

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.200 1.4e-02
hepatocellular carcinoma 1.400 2.4e-04
pancreatic cancer 1.200 3.6e-02
atypical teratoid / rhabdoid tumor -1.200 6.6e-04
glioblastoma -1.200 8.3e-04
medulloblastoma, large-cell -1.300 1.7e-04
diabetes mellitus -1.300 1.7e-03
pancreatic carcinoma 1.200 3.6e-02
ovarian cancer 1.300 1.8e-02

Gene RIF (2)

PMID Text
20430857 PHAX RNA-binding domain mediates auxiliary RNA contracts with small nuclear and mall nucleolar RNA substrates.
15574332 PHAX and CRM1 have roles in transporting U3 snoRNA to nucleoli

AA Sequence

MALEVGDMEDGQLSDSDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESF      1 - 70
SDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGAVLQEQNQDAVATELGILGME     71 - 140
GTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNR    141 - 210
PEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNGS    211 - 280
RRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKRRTQVLGKKMKQAIKSLNFQEDDDTS    281 - 350
RETFASDTNEALASLDESQEGHAEAKLEAEEAIEVDHSHDLDIF                              351 - 394
//

Text Mined References (18)

PMID Year Title
26382858 2015 mRNA export through an additional cap-binding complex consisting of NCBP1 and NCBP3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20430857 2010 Structure and RNA recognition by the snRNA and snoRNA transport factor PHAX.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16687569 2006 Ongoing U snRNP biogenesis is required for the integrity of Cajal bodies.
15574333 2004 Assembly and maturation of the U3 snoRNP in the nucleoplasm in a large dynamic multiprotein complex.
15574332 2004 PHAX and CRM1 are required sequentially to transport U3 snoRNA to nucleoli.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15130578 2004 Why do cells need an assembly machine for RNA-protein complexes?
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11333016 2001 The evolutionarily conserved region of the U snRNA export mediator PHAX is a novel RNA-binding domain that is essential for U snRNA export.
10786834 2000 PHAX, a mediator of U snRNA nuclear export whose activity is regulated by phosphorylation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.