Property Summary

NCBI Gene PubMed Count 601
PubMed Score 7682.56
PubTator Score 5388.46

Knowledge Summary

Patent (94,080)

TINX Plot

  Disease (5)

Disease Target Count
Progesterone Resistance 1

Expression

  Differential Expression (10)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... -1.100 8.1e-04
intraductal papillary-mucinous carcinoma... -1.300 4.1e-04
intraductal papillary-mucinous neoplasm ... -1.100 6.8e-03
colon cancer -1.100 2.8e-03
lung cancer -1.500 8.2e-04
interstitial cystitis -2.100 1.8e-05
posterior fossa group B ependymoma 1.300 2.2e-04
Breast cancer -2.000 2.8e-02
invasive ductal carcinoma -2.300 7.4e-03
ovarian cancer -4.200 2.0e-08

Protein-protein Interaction (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (591)

PMID Text
27069179 Neural Analyses Validate and Emphasize the Role of Progesterone Receptor in Breast Cancer Progression and Prognosis
26916548 progesterone acts via the progesterone receptor to modulate ADAMTS 1 and 4 levels in ovarian cancer cell lines.
26892043 Data demonstrated the significance of PR extranuclear signaling through PPD interactions in EGFR-mediated proliferation and signaling in NSCLC.
26829108 the MapQuanttrade mark assay, based on mRNA expression assay, provides an objective and quantitative assessment of Estrogen receptor, Progesterone receptor and HER2 status in invasive breast cancer.
26820652 TargetPrint ER had a positive agreement of 98 %, and a negative agreement of 95 % with central pathology. Corresponding figures for PgR were 85 and 94 % and for HER-2 72 and 99 %. Agreement of mRNA versus central protein was not different when the same or a different portion of the tumor tissue was analyzed or when DCIS and/or normal tissue was included in the sample subjected to mRNA assays
26579819 Analysis of patients with ER-/PgR+/HER2- breast cancers showed that this subtype exhibited an aggressive behavior compared to triple negative breast cancers.
26577046 Study indicate that PR-B isoform is the dominant driver of cellular senescence in ovarian cancer cells and reveal that dephosphorylated FOXO1 confers potent PR-B-like transcriptional activity to PR-A and is required for its phosphorylation on Ser294 and transactivation of PR-B.
26550991 Estrogen receptor, progesterone receptor or human epidermal growth factor receptor 2 samples with high-methylation risk score had the worst 5-year survival rate and overall survival time.
26517007 findings suggest that human labour may develop as a consequence of a decline in mPR(alpha+) Treg cells, which reduces progesterone anti-inflammatory action through Treg cells.
26458823 Rs11571215 in PGR (progesterone receptor) was the SNP most strongly associated with ER- disease.
26428028 Expression of seven ERalpha splice variants, total progesterone receptor (PR) and of five PR transcript isoforms was found to be significantly decreased in endometrial cancer
26403396 CORRELATION BETWEEN CLINICAL PATHOLOGY OF LUMINAL B BREAST CANCER AND DETERMINATION OF ESTROGEN RECEPTOR, PROGESTERONE RECEPTOR AND HER2 EXPRESSION COMBINED WITH NUCLEAR MORPHOLOGY.
26387168 Certain single nucleotide polymorphisms in the progesterone receptor gene are correlated with spontaneous abortions, premature labor, and recurrent miscarriages. (Review)
26340407 These findings underscore the importance of understanding the complex interactions between PR and other regulatory factors, such as Stat3, that contribute to determine the context-dependent transcriptional actions of PR.
26286601 The G allele of PGR rs660149 polymorphism was significantly associated with susceptibility to preterm birth in Malay women.
26261614 Report high p16/pHH3 expression and low progesterone expression as useful in differential diagnosis of atypical leiomyomas.
26260940 our findings revealed progesterone receptor positive (PR+) patients were significantly more likely to present with blastic than lytic or mixed lesions.
26252518 the morphological features and ER-alpha/PRA/p53 immunohistochemical expression of a sample of 45 endometrial endometrioid carcinoma metastases compared to matched primary tumors, were evaluated.
26161666 The ER-/PgR+ phenotype is associated with higher grade with HER2 overexpression/amplification and occurs more commonly in younger women.
26160085 LEss than 1% of this Pakistani breast cancer cohort were progesterone receptor positive only, though 51% were ER and PR positive.
26153859 PR functions as a molecular rheostat to control ERalpha chromatin binding and transcriptional activity, which has important implications for prognosis and therapeutic interventions in breast cancer
26053183 Demonstrate the prognostic value of PgR loss in the neoadjuvant setting, indicating that ER+/PgR- Luminal-B tumors warrant further attention due to their high risk of relapse after primary treatment.
26037298 Endometriotic lesions/eutopic endometrium from women with endometriosis are uniform in a PR-A-dominant state. Menstrual efflux of a PR-A-dominant endometrial tissue into the peritoneal cavity may play a role in the pathophysiology of endometriosis.
26036714 The expression of ERalpha and ERbeta was inversely correlated with menopausal age, which was not verified for PR. No significant association was observed between ERs or PR expression and benign or malignant endometrial pathology.
26006736 The levels of progesterone receptors in leiomyoma tissue are directly associated with the number of tumors and clinical symptoms.
25908555 Regardless of methodology, basal-like cases seldom expressed ER/ESR1 or PR/PGR and were associated with the lowest expression level of HER2/ERBB2 relative to other subtypes.
25894978 Taken together our data demonstrate that CHD8 is involved in late stages of progesterone receptor enhancers activation.
25875046 This study revealed the gene networks that operate downstream of each PGR isoform to mediate critical functions, during decidualization in the human.
25845386 negative-ER ,negative-PR ,positive-p53 and higher Ki-67 expressions were related to a higher mtDNA copy ratio. In addition, advanced T-status (p=0.019) and negative-HER-2/neu expression (p=0.061) were associated with mtDNA D310 mutations
25833156 results suggest that progesterone receptor plays an active role in regulating stromal cell phenotypes during prostate cancer progression
25802405 HER2 status was highly concordant between the paired primary and brain tumors, whereas changes of ER and PR status occurred in a substantial proportion of the patients
25778295 Progesterone receptor expression was not altered in breast cancer patients undergoing neoadjuvant chemotherapy.
25778292 Progesterone receptor status exerts a significant impact on prognosis of estrogen receptor+/HER2- breast cancer.
25723513 High progesterone receptor density in tumor cells of the prostate cancer tumor is an independent negative prognostic factor for clinical failure.
25603724 PR-A and PR-B mRNA expression was significantly lower on granulosa cells of PCOS patients compared to controls.
25600243 Ki-67 and PgR expression were independently associated with the prognosis of patients with ER+ and HER2- breast cancer
25595111 Suggest that progesterone plays a key role in the pathogenesis of renovascular fibromuscular dysplasia.
25584414 FOXO1 and PR are required for the regulation of IRF4, a novel transcriptional regulator of decidualization in human endometrial stromal cells.
25494303 suggest that the progesterone receptor gene (PGR) polymorphism does not directly predispose to migraine but significantly delays migraine onset probably via a reduction in brain neuronal excitability.
25439299 Nuclear histological expression for ER-beta was associated to sun-induced melasma and negative familiar background; PR expression was associated to sun-induced melasma and darker phototypes
25385317 The ratios of IGF-I/IGFBP-3 were increased in postmenopausal Taiwanese women with breast cancer, irrespective of their ages, ER and PR statuses, and HER2 expression.
25353185 These data indicate that both nuclear and extranuclear signaling pathways of progesterone (P4) are involved in P4-regulated p53 expression in HUVECs.
25338681 This study contributes to elucidating the intrinsic relations among breast cancer subgroups defined by ER, PR and HER2 expression via integrating mRNA and miRNA expression
25337220 Report detection of estrogen/progesterone receptor mRNA using BrightGen HR RT-qDx assay and selection of patients for tamoxifen therapy.
25281525 Loss of progesterone receptor in endometrial cancer is associated with increased proliferation, poor survival, and increases from primary to metastatic lesions.
25261374 Progesterone/estrogen receptors are expressed in different epithelial populations, and target non-overlapping pathways in the normal human breast. In breast cancer, PR becomes highly correlated with ER.
25228088 This meta-analysis suggests that the two polymorphisms of PGR, Alu insertion and Val660Leu, may contribute to ovarian cancer susceptibility as low-penetrance risk factors.
25217304 Progesterone receptor is strongly expressed in rectosigmoid endometriosis tissue.
25216078 Altogether these findings highlight a novel functional connection between OHPg/PR-B and tumour suppressor pathways in breast cancer.
25170613 In this study, PR negativity was a prognostic factor for early relapse in luminal B/HER2-negative breast cancer, while a high Ki-67 index suggested a higher risk of early relapse.
25155819 Decreased expression of MUC1 may attribute to progesterone receptor B variation in the mid-secretory phase of endometriosis endometrium
25076292 Data suggest that combined low tumor expression of PR/PGR (progesterone receptor) and PTEN (phosphatase and tensin homologue) may be used as prognostic biomarkers in subjects with pancreatic neuroendocrine tumors following surgery.
25037596 an overall modest association between the PgR +331G/A polymorphism and endometrial cancer risk was detected.
25015900 Progesterone receptor B methylation occurs with high frequency after labor onset.
24992175 Oncotype DX RT-qPCR assay for ER and PR correlation with IHC: a study of 3 different clones.
24945100 Data suggest expression of PGR in endometrium in women with endometriosis may be biomarker for subsequent fertility; PGR levels in normal range or up-regulated are indicative of fertility following medical or surgical treatment.
24943061 the results showed trend towards an increased risk of the variant PROGINS allele and susceptibility for the endometriosis.
24909783 Results indicate the mechanism of progesterone receptor (PR)-TATA box-binding protein (TBP) interactions as a model for studying nuclear receptor (NR)-transcription factor functional interactions.
24894997 Evidence that both PR-A and PR-B isoforms are expressed in the human spinal cord is provided, with some regional variation in isoform expression between amyotrophic lateral sclerosis and controls.
24851606 The loss of both hormone receptors in carcinoma cells and loss of PGR in the myometrium was a predictor of a more aggressive type of endometrial cancer and a poor prognosis.
24815444 methylation of promoter sites of ESR1 and PGR is a relatively uncommon event in ductal and lobular breast cancer, the determination of epigenetic states of ESR1 and PGR could represent an alternative or complement to histopathological expression analysis
24785095 Both OPG and progesterone receptor are independently associated with good prognosis in ER positive breast cancer.
24684970 The ratio of ER-alpha and PR-A expression in the epithelial glands and the stroma of endometrioid carcinoma biopsies may serve as an additional parameter in the histological evaluation.
24667714 CONCLUSION: TargetPrint and local assessment of ER, PgR, and HER2 show high concordance with central assessment in the first 800 MINDACT patients.
24664419 Decreased expression of the PR in cancer associated stroma may contribute to the elevated SDF-1 and IL-6 levels in prostate tumors and enhance prostate tumor progression
24606123 Interaction of phosphorylated PRs with SP1 and cyclin D1 provides a mechanism for targeting transcriptionally active PRs to selected gene promoters relevant to breast cancer progression.
24570392 PR frequently prevails over ER in pulmonary lymphangioleiomyomatosis.
24549642 High expression of PgR and low expression of p53 were significantly correlated with the improved disease-free survival.
24531693 ChIP analysis of MeCP2 binding to progesterone receptor-B (PR-B) gene in the PR-B-positive/-negative endometrial cancer samples confirmed the significant role of MeCP2 in PR-B gene silencing.
24481237 The present study aimed to gain further insight into the DNA methylation patterns of alternative promoters of the steroid receptor genes ESR1, ESR2 and PGR in intestinal deep endometriosis.
24469035 unliganded PR-B enhanced proliferative responses to estradiol and IGF1 via scaffolding of ER-alpha/PELP1/IGF1R-containing complexes
24442343 Epigenetic changes mediated by JARID1A, SMYD3 and DNA methylation may be responsible, at least in part, for the functional progesterone withdrawal that precipitates human labour.
24423317 Higher levels of PR-M and mitochondrial porin were found in the fibroid edge compared with adjacent myometrium.
24415758 These results suggest that monomethylation of PR at Lys-464 probably has a repressive effect on AF-1 activity and ligand sensitivity.
24401087 We found that Stat6 interacts with progesterone-activated PR in T47D cells. Stat6 synergizes with progesterone-bound PR to transactivate the p21 and p27 gene promoters at the proximal Sp1-binding sites
24398991 The values and the distribution of the ER and PR taken from the biopsies made in the patients with mammary carcinoma are influenced by the age and menopausal status.
24345432 Progesterone receptor rapid and nonclassical transcriptional effects govern breast cancer growth. Progesterone receptor and AP-1 nuclear interaction is a marker of good prognosis and better survival in breast cancer patients treated with tamoxifen.
24322014 calretinin immunoexpression and the hormonal status for estrogen receptors (ER), progesterone receptors (PR), and ERRB2, in 33 cases of cutaneous metastases of ductal breast carcinoma, as well as in seven primary cutaneous apocrine tumors, were studied
24302725 PR acetylation at Lys-183 by p300 potentiates PR activity through accelerated binding of its direct target genes without affecting PR tethering on other transcription factors.
24300977 Absence of PR expression is a powerful, independent prognostic variable in operable, primary breast cancer even in ER-positive
24276461 progesterone inhibits the pro-labor genes CRH and COX-2 via PR-A repression of the noncanonical NF-kappaB signaling in human placenta.
24269135 Studies indicate that changes in oestrogen receptor (ER), progesterone receptor (PgR) and epidermal growth factor receptor 2 (HER2) expression may occur during the natural history of breast cancer.
24245695 No nuclear staining could be found for any PR in human or rat inner ear except the PR-B staining in the cochlear bone.
24225150 Kisspeptin, PIBF and PR expressions in deciduas were significantly decreased in recurrent spontaneous abortion women as compared to controls
24197980 No significant association between the progesterone receptor +331G/A polymorphism and ovarian cancer was found
24162264 marker of main subtypes of invasive breast cancer in China
24114857 Progesterone receptor and estrogen receptor alpha expression are discordant in different distant breast cancer metastases.
24057181 The results of this meta-analysis indicate that the PRG polymorphism PROGINS is not associated with ovarian cancer risk.
24051696 Ki67 index, TP53 status, or PR negativity can be used to segregate ER-positive, HER2-negative tumors into prognostically meaningful subgroups with significantly different clinical outcomes.
24036907 Data suggest that serum EGF (epidermal growth factor) level is associated with PGR positivity in HER2- (EGF receptor 2-) positive metastatic breast cancer patients; high EGF level is associated with good prognosis with trastuzumab/taxane therapy.
24021827 The expression of the progesterone receptor was found in 20% (10 patients) with salivary duct carcinoma.
23995840 Regulation of the structurally dynamic N-terminal domain of progesterone receptor by protein-induced folding.
23977306 1p11-rs11249433 polymorphism is involved in breast cancer susceptibility and confer its effect primarily in estrogen receptor-positive and progesterone receptor-positive tumors.
23970345 Reversely, in the HO-8910 cells treated with CDDP alone, levels of both PGRMC1 and PGR were increased while the level of PGRMC2 was decreased
23934021 PR gene alterations are not associated with male infertility or ICSI outcome.
23907837 PROGINS did not directly impact any indicator of endometrial function. However, PROGINS caused an increase in menstrual cycle length with increasing mid-luteal progesterone levels; the opposite relationship was present in noncarriers.
23881388 Data suggest a relation between high expression level of tissue inhibitor of metalloproteinases-1 (TIMP1) and loss of progesterone receptor expression combined with fulvestrant resistance.
23880761 Progesterone receptor A stability is mediated by glycogen synthase kinase-3beta in the Brca1-deficient mammary gland.
23873108 Data indicate that B cell-specific Moloney murine leukaemia virus integration site 1 (BMI1) gene was co-regulated with progesterone receptor (PR) in the invasive ductal breast carcinoma.
23859042 Pumpkin seed extract downregulates ER-alpha and upregulates progesterone receptor in the MCF-7 breast cancer cell line.
23818363 Human PEBP4 expression correlates negatively with estrogen and progesterone receptors in endometrial carcinoma.
23818347 Progesterone receptor levels were altered after neoadjuvant chemotherapy in breast cancer.
23818346 Immunohistochemical expression of progesterone receptor was not associated with characteristics of invasive breast cancers.
23812730 Data indicate that in breast cancers with no lymphatic metastasis, the expression of HtrA3 was lower in patients with estrogen receptor (ER)- and progesterone receptor (PR)-positive tumors.
23810009 Data suggest KLF5 (Kruppel-like factor 5) activity is regulated by progesterone/estrogen in normal mammary gland and in breast cancer; KLF5 participates in progesterone/PGR and estrogen/estrogen receptor signaling and breast tumorigenesis. [REVIEW]
23764995 Progesterone receptor SNPs rs590688 and rs10895054 are significantly associated with breast cancer in African American women.
23757214 ER, PR, and HER2 expression in the biopsy and final pathology are still needed for selecting patients for postoperative adjuvant treatment in clinical practice.
23723333 This study confirms that discordance in ER and PR receptor expression between the primary breast tumor and the corresponding metastatic lesions is high, whereas HER2 status remains relatively constant.
23706170 Coordinate immunoexpression patterns of estrogen receptor, progesterone receptor, and Wilms tumor 1 have a high specificity but low sensitivity in distinguishing between endometrial serous carcinomaand ovarian serous carcinoma
23699411 results highlight the importance of the unliganded PR in hormonal regulation of breast cancer cells.
23687977 Data show that the expressions of ER-alpha, PR, LIF, VEGF, iNOS and CB1 in fallopian tube and chorionic villi of tubal pregnancy were not altered by exposure to levonorgestrel emergency contraception.
23668054 Expression of the progesterone and Estrogen Receptors can significantly affect therapeutic decisions in selected patients with endometroioid endometrial cancer.
23666965 Data suggest that both PRA and PRB isoforms play inhibitory roles in prostate stromal cell proliferation via inhibition of expression of cyclin A, cyclin B, and cdc25c (cell division cycle 25C protein) thus delaying cell cycling through S/M phases.
23603247 FOXO1/IGFBP-1 axis is essential for PRB-dependent growth inhibition of endometrial epithelial cells
23574718 these findings support a role for PR as a tumor suppressor in ovarian cancer cells, which exhibits inhibitory effects by inducing FOXO1-dependent cellular senescence.
23570281 ER+ /PR+ /TFF3+ /IMP3- immunoprofile distinguishes endometrioid from serous and clear cell carcinomas of the endometrium.
23558572 Defining luminal B tumors by the presence of high-risk criteria (loss of PR-expression or increased proliferation) provides a robust and highly significant stratification of ER-positive breast carcinomas into luminal A and B.
23518922 PR-M localizes to mitochondria.[PR-M]
23506845 Decreased PGDH expression is associated with increased GR and PRA, although decreased PRB, in chorion during labor.
23490124 Estrogen/progesterone receptors are expressed in the larynx of the female human vocal fold in conjunction with edema.
23485561 Progesterone receptor isoform A (PRA) coexpression potentiates PRB-mediated migration, whereas PRA alone is ineffective.
23474171 PR-B expression is regulated by methylation and not by histone acetylation in U373 cells
23397283 our results suggest that the detection of ESR1/PGR/ERBB2 mRNA levels by RT-QPCR is a better approach for subtyping breast cancer and predicting the prognosis.
23349706 PgR +331G/A polymorphism might be associated with an increased female reproductive cancer risk
23339407 Taken together, our findings offer evidence that in human breast cancer RhoB acts as a positive function to promote expression of ERa and PR in a manner correlated with cell proliferation.
23307470 WNT10B/beta-catenin signalling induces HMGA2 and proliferation in metastatic breast cancer tumours devoid of ERalpha, PR and HER2 expression.
23222299 Tumors from obese animals also displayed increased expression of the progesterone receptor (PR). Elevated PR expression positively correlated with tumor expression of glycolytic and lipogenic enzymes, glucose uptake, and proliferation markers.
23209664 progesterone acts via GR to repress IL-1beta-driven COX-2 activation; p65 and PRB may have roles in the repression of progesterone driven gene expression, but not necessarily in progesterone repression of IL-1beta-induced COX-2 expression
23199240 Data indicate that estrogen receptor alpha, estrogen receptor beta, progesterone receptor and androgen receptor may be partly involved in gastric carcinogenesis but their clinicopathological and prognostic significance appears to be limited.
23177737 The progesterone receptor requires nucleosomes for optimal binding and function.
23060300 In addition to a statistically significant association between Nottingham grade and Oncotype DX recurrence score categories, an inverse relationship was identified between progesterone receptor expression and Oncotype DX recurrence score
23029355 Progesterone receptor-responsive transcription is highly influenced not only by the presence of hormone but also by selective progesterone receptor isoform expression.
23022996 progesterone receptor loss identifies Luminal B breast cancer subgroups at higher risk of relapse and death, both with HER-2-positive and HER-2-negative disease.
23018797 Fetal association with preterm birth was found in the progesterone receptor (PGR, rs1942836; P=0.004).
22972951 The predictive capacity of 32 genome wide association studies-detected common variants for breast cancer risk, alone and in combination with classical risk factors, and for tumours with different hormone receptor status, was investigated.
22808109 The associations of 6 selected polymorphisms in three genes: ESR1 (rs2234693, rs9340799, rs1801132), ESR2 (rs1271572, rs1256049) and PGR (rs1042838) with gallbladder cancer risk, were examined.
22727345 Among women with atypical hyperplasia (but not complex hyperplasia) on progetin therapy, high progesterone receptor expression was associated with decreased risk of disease persistence/progression.
22722322 No evidence was found that the PROGINS-associated SNPs alter PR functional properties.
22697792 study concludes that reversible PR SUMOylation/deSUMOylation profoundly alters target gene selection in breast cancer cells; phosphorylation-induced PR deSUMOylation favors a permissive chromatin environment via recruitment of CBP and MLL2
22633539 Our findings support an association between genetic variants in CYP19, and possibly PGR, and risk of endometrial cancer.
22613790 In this review, the results suggest that HSD17B1 and PR polymorphism may play a role in the risk of endometriosis
22590818 The epithelial component demonstrated the expression for ER-alpha (45.6%, 36 of 79), ER-beta (37.2%, 29 of 78), PR (91.1%, 72 of 79), and AR (10.1%, 8 of 79).
22580007 A consistent enrichment of PR transcripts, relative to estrogen receptor transcripts, in the bipotent progenitor subfraction in the normal human breast, is reported.
22564243 CAV-1 affected cell growth of lung cancer NCI-H446 cell through the interactions with p-ERK1/2, estrogen receptor and progestin receptor
22545144 The study presents the relationship between progesterone receptor genomic interaction and transcriptional response in breast cancer cells and immortalized normal breast cells.
22535964 X-ray structures of progesterone receptor ligand binding domain in its agonist state reveal differing mechanisms for mixed profiles of 11beta-substituted steroids.
22529366 Data suggest an important role of miR-200a in the decline in progesterone receptor (PR) function leading to labor.
22509838 Based on a limited selection of gene variants, no involvement of SRD5A1, SRD5A2, ESR1, ESR2 or PGR in female pattern hair loss is evident.
22496908 The data support the hypothesis that progesterone modulates the activities of the PI3K and cell proliferation pathways through caveolar membrane bound growth factor receptors such as progesterone receptor alpha and growth factor receptors.
22492871 miR-98 and miR-181a through their regulatory functions on PGRMC1, PGR, CYP19A1, TIMP3, and DDX3X expression may influence a wide range of endometrial cellular activities during normal menstrual cycle and transition into disease states.
22466340 TGFbeta1 has endogenous anti-progestational effects in stromal cells and the opposing effects of progesterone and TGFbeta1 are important in regulation of matrix integrity in human endometrium.
22419721 At parturition, the rise in PR-A expression promotes labor by inhibiting the antiinflammatory actions of PR-B and stimulating proinflammatory gene expression in response to progesterone.
22414972 68.3% of patients were ER-positive, and 71.5% were PR-positive. Among the 28.3% of HER2-positive tumors, the majority (19.2%) stained +++. Almost 50% of the tumors were ER+ PR+ HER2-, which makes this the predominant tumor type.
22394363 EGFR overexpression relates to triple negative profile (ER-/PR-/HER2-) and poor prognosis in breast cancer patients in Tunisia
22369759 the PR-A promoter is epigenetically marked for activation in term myometrium more extensively than the PR-B promoter, and labour is associated with an increase in H3K4me3 activating modification
22329840 Data suggest that down-regulation of 14-3-3 sigma plays a role in tumorigenesis in myometrium leading to leiomyoma; this mechanism may involve up-regulation of progesterone receptor and estrogen receptors.
22290394 ER/PR and HER2 statuses between primary and liver metastatic lesions of breast carcinoma can be modified after treatment but are stable in most cases during the natural metastatic process.
22281037 Report transient expression of progesterone receptor and cathepsin-l in human granulosa cells during the periovulatory period.
22217299 Immunohistochemistry for progesterone receptor and p53 is valuable as an adjunct tool to morphological assessment of problematic uterine smooth muscle tumors.
22203942 The predictive value is amplified when the ER status is correlated with the PR status.
22201220 Homologous receptors progesterone receptor B and estrogen receptor-alpha bind an identical promoter layout using differential energetics, thus differentially partitioning their binding energetics.
22199306 p27KIP1 has a role in node-negative breast cancer, but the interaction with ER and PR is only significant in T1a/b stage
22119825 Invasive ductal mammary carcinoma type was analyzed for comparative investigation of hormonal receptors (estrogen receptor ER and progesterone receptor PR) and Her2/neu oncoprotein expression.
22107784 The prognostic impact of Akt (Akt1) phosphorylated at threonine308 and serine473, Akt2, Akt3, PI3K and PTEN, alone and in coexpression with ER and PgR in non-gastrointestinal stromal tumor soft tissue sarcomas.
22105149 A strong indication was not found that genetic variation in progesterone receptor was associated with mammographic density increase or modified the association with serum progestogen.
22102068 ER-alpha and PR may be useful markers predicting therapy response in endometrial hyperplasia.
22093824 these data suggest that AMPK, an energy sensor, is involved in the regulation of PR signaling.
22092403 Expression of PR and ESR1 defines a subgroup of ovarian carcinomas with a favourable prognosis
22057681 The expression of PCNA, ER, and PR showed no correlation with cancer progression (P > 0.05).
22047608 Data suggest that progesterone receptor-A expression is up-regulated in decidua by TNF-alpha during parturition; thus, TNF-alpha plays important role in regulating progesterone withdrawal in decidua following labor onset.
22022496 Gene expression signatures comprising 24, 51 and 14 genes predictive of ER, PR and ERBB2 status respectively, were investigated.
22004841 Reduced progesterone receptor is associated with recurrent breast cancer.
21980607 Differential expression of progesterone receptors in endometrial polyps and adjacent endometrium in postmenopausal women
21901395 Data show that hierarchical clustering based on mRNA expression of estrogen receptors, progesterone receptor and neu receptor by quantitative RT-PCR identified patient groups that were comparable to the subtypes identified by immunohistochemistry.
21877015 the present study suggests that the presence of progesterone receptor polymorphism in our population does not constitute a risk factor for premature birth
21840910 analysis of Aurora A and B kinases, Ki-67 and the estrogen and progesterone receptors from an endometriosis tissue microarray model
21840784 breast tumors with both cyclooxygenase-2 and progesterone receptor overexpression were related with tumor lower size and lower axillary node metastasis
21816898 Imbalance in PRA/PRB ratio frequently associated with carcinogenesis might be a direct consequence of disorders in MAPK signaling.
21815951 data indicate that ligand-bound PR-B is recruited to DNA elements in the TH promoter and acts as a transcriptional activator of the TH gene
21764500 the odds of endometriosis related infertility did not increase in the presence of a combination of polymorphisms in LHbeta, ERbeta,and Progesterone Receptor.
21762477 Data show that triple-negative breast cancer (TNBC) are larger in size compared with other subtypes and almost all grade 3.
21751163 there is a significant correlation between progesterone receptor gene polymorphism and endometriosis.
21749714 Data show that the triple-negative and HER2 subtypes were associated with poorer outcomes compared with the luminal A subtype.
21736840 ER and PR do not appear to have a role in how dietary folate and vitamin B6 intakes are inversely associated with breast cancer risk
21700456 Menopausal status played a very important role in determining HER2 and PgR status in ER(+) breast cancer patients. HER2 was independently inversely associated with PgR only in the postmenopausal women with ER(+) breast cancers.
21655654 The prognostic value of the correlations between the expression of estrogen and progesterone receptors, Ki67 expression and the histological stage, tumor stage, the degree of myometrial and vascular invasion, was investigated.
21619605 Contrary to common opinion, growth inhibition of cancer cells by antiprogestin MF is not dependent upon expression of classical, nuclear PR.
21600232 expression of PR was observed in the nucleus and/or extranuclear compartments in the majority of human tumor specimens
21544804 A significant inverse association for ER+/PR+ as well as ER-/PR- tumors was observed.
21518957 Data suggest that phospho-Ser81 progesterone receptors (PR) provides a platform for casein kinase 2 recruitment and regulation of selected PR-B target genes.
21491087 analysis of estrogen and progesterone receptor expression in HPV-positive and HPV-negative cervical carcinomas
21464042 FGFR-2, STAT5, and progesterone receptors have roles in breast cancer
21459801 this article shows for the first time that PRA methylation plays a unique role in tamoxifen-resistant breast cancer.
21447625 activated progesterone receptor (PR) recruits the chromatin remodeling complexes NURF and ASCOM (ASC-2 [activating signal cointegrator-2] complex) to hormone target genes.
21444077 Suggest ER-beta expression and lack or progesterone receptor are related to the development and/or progression of adenomyosis and might explain the poor response of adenomyosis-associated menstrual symptoms to progestational agents.
21437249 A comprehensive immunohistochemical study was performed to investigate the protein expression of eight CT genes in 454 invasive ductal carcinomas, including 225 ER/PR/HER2-negative (triple-negative) carcinomas.
21432776 PRA expression is significantly lower in intermediate trophoblastic cells of miscarriages compared to elective abortion pregnancies
21422407 Preferential exemestane versus tamoxifen treatment benefit was not predicted by PgR expression; conversely, patients with ER-rich tumors may derive additional benefit from exemestane.
21397694 Differential expression of 4 out of 5 genes related to estrogen metabolism and action (ESR1, ESR2, PGR and BGN) was confirmed in endometriosis.
21340479 Unliganded PR-A alters the gene expression pattern controlled by taxanes, especially multiple genes involved in the spindle assembly checkpoint, a group of proteins that insure proper attachment of microtubules to kinetochores during mitosis.
21271213 Progesterone receptor expression in non gastrointestinal soft tissue sarcoma was a negative prognostic indicator in men
21269613 The higher PR-A and ER-alpha gene expression in granulosa cells in patients with endometriosis, compared with patients with tubal infertility, might be a leading cause of ovarian dysfunction due to endometriosis
21243274 PROGINS polymorphism is not related either to endometriosis-associated infertility or to idiopathic infertility in the population studied
21184272 Tamoxifen and raloxifene reduce progesterone and estrogen receptor alpha expression significantly and to a similar extent in the non-neoplastic breast tissue of women of reproductive age
21152841 The presence of PROGINS polymorphism was not significantly associated with endometrial polyps
21152100 Studies indicate that aUPD is a common and non-random molecular feature of breast cancer that is most prominent in HER2/ER/PR triple negative cases.
21148628 Progesterone receptor gene variants are associated with endometrial cancer.
21145845 reduced expression of PR and PIBF, a higher IL-12/IL-10 ratio, and a high viral load results in poor pregnancy outcome in hepatitis E
21141441 both maternal and fetal mutated alleles of the PROGINS progesterone receptor polymorphism seem to protect from transient tachypnea of the newborn (TTN); fetal as well as maternal T2-alleles synergistically reduce risk for TTN in gene dose-dependent manner
21119048 CDB-4124 has an effect on progesterone and estrogen receptors, and may suppress the development of precancerous lesions
21095220 16alpha-hydroxyprogesterone can bind to both hPR-A and hPR-B and act as an agonist for both receptors.
21093858 A direct role for the PROGINS polymorphism in the risk of developing ED; however, further examination of other variants within PR gene will be necessary to completely rule out an effect.
21086036 PROGINS polymorphism confers susceptibility to idiopathic recurrent pregnancy loss in Taiwanese Han women.
21086036 Observational study of gene-disease association. (HuGE Navigator)
21085752 Observational study of gene-disease association. (HuGE Navigator)
21062926 The lung tumors with high progesterone receptor may define patients with aggressive biology.
21029696 ER, PR and Her-2 are independent prognostic factors for locoregional recurrence and survival in node-positive breast cancer patients treated by mastectomy.
20962507 ERalpha correlated positively with progesterone receptor expression (normal controls), and maternal BMI at delivery (fetal growth restriction).
20960162 identification of new splicing variants of progesterone receptor in human endometrium
20959426 PGR PROGINS insert polymorphism does not appear to be associated with migraine
20959426 Meta-analysis of gene-disease association. (HuGE Navigator)
20956022 No association was found between recurrent spontaneous abortion and gene polymorphisms in the progesterone receptor gene.
20956022 Observational study of gene-disease association. (HuGE Navigator)
20946440 results showed that varicocoele may lead to male factor infertility by a mechanism involving a decreased PR expression in human spermatozoa that evidences a detrimental effect on spermatozoa at the molecular level
20920367 estrogen receptor, progesterone receptor, and HER-2 may have a role in progression in breast cancer despite response to doxorubicin/cyclophosphamide therapy
20890067 Data show that DFS was statistically different between the two groups: 65.0% for (HER2+/ HR-) and 74.6% for the (HER2+/ HR+) patients (p=.045).
20873988 Studies indicate that breast carcinomas Oncotype DX Recurrence Score (RS) was correlated with six pathobiologic features: ER, PR, and EGFR2 status, and the three components of the Nottingham tumor grade.
20872186 Estrogen receptor/progesterone receptor status (and nm23-H1) are independent predictive factors of pathologic complete response to neoadjuvant docetaxel plus epirubicin combination chemotherapy in patients with locally advanced breast cancer.
20861224 These data reveal the ability of PR acetylation to alter the magnitude of transcriptional response at selected promoters whereas the hinge region dictates the kinetics of the transcriptional response at other promoters.
20844986 Histological grade and estrogen receptor/progesterone receptor status were significant for pathological complete response in breast cancer patients.
20829392 E3-ligase activity rather than the coactivation function of E6-AP plays an important role in the mammary gland development, and the ubiquitin-dependent PR-B degradation is not required for its transactivation functions.
20814185 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20719308 The occurrence of endometriosis was reduced in women carrying one or more copies of the +331 T allele, whereas there was no association between the PROGINS allele and endometriosis
20719308 Observational study of gene-disease association. (HuGE Navigator)
20716560 Observational study of gene-disease association. (HuGE Navigator)
20713855 The addition of progesterone receptor and HER2 to Nottingham Prognostic Index increases its 5-year prognostic accuracy in breast cancer.
20690804 Studies show that data PR negative tumors have significantly higher RS than PR positive tumors.
20661446 Study observed the strongest interaction between progesterone receptors-Hsp90 heterocomplex and CHIP, FKBP51, and TPR2.
20646629 In sporadic breast carcinoma, a negative expression of BRCA1 is selectively associated with a higher expression rate of progesterone receptor A rather than progesterone receptor B.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20592363 phytoestrogen extracts isolated from flax have effects on estradiol production and ER/PR expression in MCF7 breast cancer cells
20586553 Observational study of gene-disease association. (HuGE Navigator)
20557310 Data show that the concordance rates of histological type, estrogen receptor and progesterone receptor status, and HER2 were 84.4%, 81.3%, 92.9%, and 89.3%, respectively between CNB and surgical specimens.
20550710 The HER4 intracellular domain is a physiologically important ERalpha coactivator and cooperates with ERalpha to potentiate PgR expression in the normal and malignant breast.
20547493 Genetic variation in the PGR region is associated with endometrial cancer risk, particularly among Whites.
20547493 Observational study of gene-disease association. (HuGE Navigator)
20484415 Studies indicate that PPARgamma activation inhibits PRB activity through both acute (phosphorylation) and long-term (PRB degradation) pathways.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20436503 This paper briefly reviews the assessment of ERalpha, PgR, and HER2 in breast cancer, emphasizing recent progress and persistent controversies.
20404095 Cyclin D1's participation in a feed-forward loop could contribute to increased breast cancer risks associated with estrogen and progesterone combinations.
20400074 When endometrial stromal cells from both groups of women were differentiated to decidual phenotype, PROK1 mRNA was up-regulated and PR and HOXA10 mRNA were down-regulated to the same extent.
20392877 These data link the SMRT corepressor directly with SRC family coactivators in positive regulation of ERalpha-dependent gene expression.
20381444 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20374701 Studies examining the expression and function of the PRs in the normal endometrium and myometrium as well as in endometrial cancer and uterine leiomyoma are summarized here.
20337826 Expression of PR was significantly increased in the epidermal lesions compared with unaffected skin in melasma
20335148 The positive correlations in positivity rate between the PRL-R and ER/PR expressions are found only in CerbB-2 positive patients with breast cancer.
20308837 the hPR gene may be a candidate for association with preterm birth or familial preterm birth
20308837 Observational study of gene-disease association. (HuGE Navigator)
20308044 ER+/PR- tumors more frequently showed HER2 (human epidermal growth factor receptor) overexpression and represent a distinct subset in familial breast cancer patients.
20305341 Results describe the expression of estrogen receptor alpha, estrogen receptor beta, progesterone receptor and cKIT in a number of desmoids tumors and their role in determining treatment options.
20299092 CpG islands aberrant hypermethylation of progesterone receptor is associated with leukemia.
20228224 subcellular localization of activated AKT is dependent on TCL1B expression in estrogen receptor- and progesterone receptor-expressing breast cancer
20167054 In endometrioid carcinoma detected a positive staining with c erbB 2 in 18.1% of the cases and determined a statistically significant relation between c-erbB-2 and PR.
20148360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20124487 KLF11 as an integrator of progesterone receptor signaling and proliferation in uterine leiomyoma cells.
20123965 Data show that progesterone receptor-B acts in both direct and indirect manners to positively upregulate E2F1 expression.
20097334 No statistically significant differences in both P receptor-A/P receptor-B messenger RNA and protein ratio between endometrial stromal cells derived from women with and without endometriosis.
20096719 A comparison the human membrane progesterone receptor alpha (mPRalpha) and nuclear progesterone receptor (nPR) revealed several differences in the structural features required for binding to hu-mPRalpha and nPR.
20090851 results suggest that the progesterone receptor gene mutations may not play any exclusive role in the manifestation of recurrent spontaneous abortion
20090851 Observational study of gene-disease association. (HuGE Navigator)
20087433 The progesterone receptor (PGR) is a nuclear receptor transcription factor that is essential for female fertility--REVIEW
20087430 we examine the role of nuclear localization of PGR, coregulator association and tissue-specific expression in modulating progesterone action in the human--REVIEW
20082875 Results suggest that, in breast cancer, Par-4 plays a similar tumor suppressor gene role as reported in endometrial carcinoma, and that Par-4 expression has a significant inverse association with expression of progesterone receptor.
20082859 meta-analysis: we could carefully suggest that the progesterone receptor promoter +331 G/A variant polymorphism might increase breast cancer risk, and this effect appeared to be more prominent in Americans than in Europeans and Australians
20082859 Meta-analysis of gene-disease association. (HuGE Navigator)
20076999 Polymorphisms in progesterone receptor gene is not associated with breast cancer.
20076999 Meta-analysis of gene-disease association. (HuGE Navigator)
20063045 The 4th passage cell cultures from Fallopian tube muscularis exhibiting interstitial Cajal-like cells morphology showed the presence of ER-alpha and/or PR-A by immunofluorescence.
20026682 oxidative stress induced by relatively low levels of H2O2 rapidly activate JNK signaling in endometrial stromal cells, which, in turn, enhances global and PR specific SUMO-1 conjugation, thereby inhibiting progesterone responses.
20019164 Progesterone upregulation of Gs proteins increases VIP-induced inhibition of intestinal smooth muscle cell contraction mediated by progesterone receptor A.
20000807 PR self-association and DNA-dependent cooperativity are linked to a monovalent cation binding event and that this binding is coupled to modulation of receptor structure. K(+) and Na(+) are therefore allosteric effectors of PR function
19996313 Data show that the small molecule celastrol inhibits the Hsp90 chaperoning machinery by inactivating the co-chaperone p23, resulting in a more selective destabilization of steroid receptors.
19961842 The objective of this study was to determine the concordance of promoter methylation of stratifin, ERalpha and PR in tumor and circulating DNA in breast cancer patients and their association with clinicopathological parameters and disease prognosis.
19952937 An immunochemical study of the expressions of Ki-67, estrogen receptor, progesterone receptor, and p53 in 9 cases of symplastic uterine leiomyomas was performed.
19952285 Results from MCF-7 cells suggest that distal regions of PR gene participate in the dynamic regulation of this estrogen-responsive gene; these regions range from 311 kb upstream to 4 kb downstream of the PR-B transcription start site.
19940364 Promoter hypermethylation was observed in PRB 67%, ERalpha 64%, RASSF1A 63%, p16INK4A 51%, RARbeta2 22%, GSTP1 25% and BRCA1 27% of the breast cancers, respectively.
19940123 NF1 binding to the MMTV promoter on a H3/H4 histone tetramer particle exposes the central HREs and facilitates their binding by PR
19913121 Observational study of gene-disease association. (HuGE Navigator)
19887485 estrogen receptor (ER), progesterone receptor (PR), and HER2 have roles in breast cancer
19852793 Successful PG-E2 priming was followed by a progesterone and androgen withdrawal at the receptor level in the uterine cervix.
19846565 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19838027 triple negative (estrogen receptor, progesterone receptor, and human epidermal growth factor receptor 2) breast cancer in young women has a significantly poorer prognosis for both disease-free survival rate and overall survival rate.
19835506 abnormal expression of hormone receptor contribute to endometrial polyps formation
19820388 Disorders of Connexins expression and altered distribution pattern occur during endometrial carcinogenesis, and it seems that PR could participate in this fact.
19809499 Catechol-o-methyltransferase expression and 2-methoxyestradiol affect microtubule dynamics and modify steroid receptors ERalpha and PR signaling in leiomyoma cells
19782484 investigated the impact of the functional +331G/A hPR polymorphism on the association of venous thromboembolism with hormone therapy..hPR polymorphism appears not to have a significant effect on VTE risk related to HT.
19782484 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19762712 The aim of the current study was to assess the expression levels of c-Src and phosphorylated Src kinase in human breast cancers and to establish if these are linked to oestrogen receptor, progesterone receptor, and HER2 status or patient survival.
19739075 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19720911 Studies show that the intrinsic molecular signature of five markers, ER, PR, HER-2, CK 5/6, and EGFR, demonstrated specificity of 100% and sensitivity of 75%, compared with classification by gene expression profiling.
19715581 Findings show the presence and hormonal regulation of two distinct mPRs associated with the cilia of the fallopian tubes in both mice and women.
19706513 Data explain why breast cancer models often remain insensitive to progestins, but are growth-inhibited by antiprogestins, and underscore the need to target PR-B and associated kinase activities as part of breast cancer therapy.
19701771 our data report the regulation of TRPV4 expression by progesterone, a process that requires a functional progesterone receptor
19696694 The AA variant of the progesterone receptor polymorphism was associated with profound cardiovascular/metabolic effects determined by fetal sex.
19696694 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19676041 Data show that in multivariate analyses incorporating tumor size, tumor grade, lymph node status, ER, PR and HER2 status, low STARD10 expression was an independent predictor of death from breast cancer.
19673915 PROGINS polymorphism seems to play a protective role in genetic susceptibility to migraine in the North Indian population
19657752 The positive expression rate of PgR decreased significantly from DCIS to invasive ductal breast carcinoma. A significant positive correlation was observed between ER and PgR receptor expression in DCIS and IDC.
19636371 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19604497 Observational study of gene-disease association. (HuGE Navigator)
19574486 ER, PR and Her2 have roles in progression of breast cancer
19574343 Observational study of gene-disease association. (HuGE Navigator)
19555469 Observational study of gene-disease association. (HuGE Navigator)
19551860 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19499404 Progesterone may down-regulate IGF-I through PRB. PRA may inhibit this function of progesterone by inhibiting transcription of PRB. Action of progesterone on leiomyoma growth may depend on different ratios of PRA and PRB.
19497994 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19476621 The three markers (ER, Vim and CEA) and their respective panel expressions showed statistically significant (p < 0.05) frequency differences between endocervical adenocarcinomas and endometrial adenocarcinomas tumors.
19462450 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19458022 Results supporting both the androgen and gonadotropin hypotheses of ovarian cancer development.
19436038 Expression of ER, progesterone receptor, and HER2 proteins and the Ki67 index appear to distinguish luminal A from luminal B breast cancer subtypes
19423654 p54nrb is a transcriptional corepressor of the progesterone receptor that modulates transcription of the labor-associated gene, connexin 43 (Gja1)
19423537 Our data provide persuasive evidence against an overall association between invasive breast cancer risk and ERCC4 rs744154, TNF rs361525, CASP10 rs13010627, PGR rs1042838, and BID rs8190315 genotypes among women of European descent.
19423537 Meta-analysis of gene-disease association. (HuGE Navigator)
19419938 The distinct expression of ER and PgR in ductal breast cancers, dependent on evaluated zone of the tumour, confirms its heterogeneous character and exerts an effect on the type of applied treatment.
19415745 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19389812 BRCA1 inhibits progestin-stimulated PR activity, in part, by preventing PR from binding to the PRE and by promoting the formation of a corepressor complex rather than a coactivator complex
19383545 Data show that progesterone and synthetic steroids with progestin potencies counteract cell growth through induction of catalase activities, possibly through progesterone receptor B, in breast cancer cells and normal human epithelial breast cells.
19382201 The current findings suggested that polymorphisms in the 3' flanking region of the PGR gene may be associated with the risk of endometrial cancer.
19382201 Observational study of gene-disease association. (HuGE Navigator)
19372234 In natural promoters the coRE functions as a composite response element with imperfect PRE and half-sites to present variable, orientation-dependent transcription factors for interaction with nearby PR.
19367380 A role of PRs in the growth and development of fibroadenomas, although without alterations of the PRA:PRB ratio in these tumors.
19339282 These findings are suggestive of a role for myometrial PSF as a nuclear co-regulator in the regulation of specific hormone receptor genes and their target hormone response genes.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19330259 Observational study of gene-disease association. (HuGE Navigator)
19309393 Increased expression of steroid receptors in lobular carcinoma in situ (LCIS) of the breast suggests their possible role in the biology of LCIS and, for PR, could influence the predisposition of women with LCIS to develop invasive breast carcinoma.
19299443 The distinction between the two modes of action of progesterone receptor (PR) on the control of gene expression and cell proliferation, was studied.
19296948 Compared with normal endometrium, progesterone receptor isoform B (PR-B) and IkappaBalpha immunoreactivity were statistically significantly reduced in ectopic as well as eutopic endometrium from women with adenomyosis.
19284643 The major PR isoform in the amnion, chorion and placenta is a cytoplasmic 60 kDa protein with a suggested role in the regulation of human parturition.
19267271 Older age, increased body mass index, menopausal status, and PGR rs484389 genotype CT were significantly associated with POP. The present study shows that PGR genotype may be associated with POP.
19267271 Observational study of gene-disease association. (HuGE Navigator)
19258476 The combination of RARB M4, INK4a/ARF, PRB, and HIN-1 CpG island promoter methylation may predict non-BRCA1/2-associated mammary carcinogenesis and tumor progression.
19220894 Progesterone receptor A has a functional role inendometrial receptivity in the attachment process.
19217090 Expression of estrogen (ER) and progesterone (PR) receptors in the smooth muscle component (SMC) of deep infiltrating endometriosis.
19211567 SUMOylation tightly regulates the transcriptional activity of PR by repressing the receptors directly while activating them indirectly through augmented SRC-1 coactivation
19208313 ER and PR showed inverse association with HER-2/neu while positive association was seen with lymph node metastases in breast carcinoma patients in Pakistan
19208263 Data indicate that the level of HCCR-1 in breast cancer tissues is correlated with the HER2 overexpression, p53 mutation, and ER/PR status, and determination of HCCR-1 levels as options for HER2 testing is promising although it needs further evaluation.
19205877 progesterone receptor may have a role in mediating response to adjuvant tamoxifen therapy in breast cancer and patient survival
19205874 PRA expression decreased from a mean of 17.8% of epithelial cells in cycling subjects to 6.2% in pregnant subjects. PRB and ERalpha expression was slightly lower in pregnant subjects but the differences were not statistically significant.
19196877 findings suggest that the decidua, and not the amnion and chorion, is a direct target for nuclear progesterone receptor-mediated progesterone actions during human pregnancy
19175383 Our study does not support a major contribution of the estrogen receptor gene and progesterone receptor gene to the pathogenesis of migraine.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19154258 Hepatocyte nuclear factor 4alpha (HNF4alpha) isoform and progesterone receptor were expressed in pancreatic alpha-cells, but not beta-cells in the human pancreas.
19152063 Observational study of gene-disease association. (HuGE Navigator)
19147702 Results provide evidence for a mechanism by which overexpressed progesterone receptor-B is able to actively repress estrogen receptor alpha gene expression.
19147544 KLK4 is only expressed in breast and prostate cancers that express the progesterone receptor (PR) and androgen receptor (AR), respectively.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19106225 Progesterone feedback at the level of the pituitary gonadotrope is likely to play a key role in differential production of the gonadotropin genes.
19095059 These results suggest a differential PR isoforms regulation depending on the evolution grade of human astrocytoma cells.
19094228 Observational study of gene-disease association. (HuGE Navigator)
19093516 Clinicopathological significance of the progesterone receptor and its association with thymidine phosphorylase expression in colorectal cancer.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19061285 Presence of estrogen and/or progesterone expression in neuroendocrine tumors involving the lung should not exclude a primary pulmonary neoplasm.
19056530 PR localization and expression in the ovaries of postmenopausal women who have not applied hormone replacement therapy
19031960 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18980792 Data show that PR expression is higher in the meningiomas positive for GnRH-R and a significantly higher proportion of tumors from male patients exhibit positive immunoreactivity for GnRH.
18850387 Short-term oral contraceptives yielded lower ERalpha and PR contents. Postmenopausal estrogen/progestogen combined therapy yielded lower PR content than estrogen-only therapy.
18835831 PR and ERalpha may play a role in the pathogenesis of the maturation arrest and Sertoli cell-only phenotype in patients with infertility
18819936 Progesterone receptor-B regulation of insulin-like growth factor-stimulated cell migration in breast cancer cells via insulin receptor substrate-2.
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18801410 Report detection of potential (anti)progestagenic endocrine disruptors using a recombinant human progesterone receptor binding and transactivation assay.
18798271 Estrogen alpha and progesterone receptor may have a role in preventing progression of breast cancer
18776045 Overexpression of progesterone receptor B increases sensitivity of human colon muscle cells to progesterone.
18722616 Observational study of gene-disease association. (HuGE Navigator)
18691687 Observational study of gene-disease association. (HuGE Navigator)
18686353 Endometrial inflammation interferes with local expression of estrogen receptor, progesterone receptor and Ki-67 antigen
18683043 Local recurrences of invasive breast carcinoma were associated with high-grade tumors, PR-negative and low active-IGF1R
18681990 Semi-quantitative assessment of PR expression in the testicular biopsies of infertile men demonstrating different phenotypes indicated a direct relationship between PR expression and extent of spermatogenesis.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18668363 There was no significant associated between progesterone receptor gene transcription and benefit from endocrine therapy or for outcome in early breast cancer
18665217 progesterone receptor signaling has a role in breast cancer cell movement and invasion through the actin cytoskeleton
18645713 findings in breast cancer patients suggests that antiproliferative effect of androgens may be mediated via downregulation of progesterone receptor
18636124 Observational study of gene-disease association. (HuGE Navigator)
18631401 estrogen/ER-responsive breast cancer genes linked to cell growth and invasion pathways are associated with loss of PR and earlier disease-specific mortality
18629635 we emphasize the important short-term prognostic value of currently used immunohistochemical markers for ER, PR, and HER-2
18628428 Observational study of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18617611 Systematic expression analysis and antibody screening do not support the existence of naturally occurring progesterone receptor (PR)-C, PR-M, or other truncated PR isoforms.
18557990 analysis of alternative splicing of the progesterone receptor in breast cancer
18511503 The androgen and progesterone receptors regulate distinct gene networks and cellular functions in decidualizing endometrium.
18510611 Observational study of gene-disease association. (HuGE Navigator)
18508999 PR concentrations were high in normal adrenal and adrenal tissues adjacent to adrenocortical adenoma, and were even higher in tumors carcinoma - and in isolated primary pigmented nodular adrenocortical disease
18483761 Observational study of gene-disease association. (HuGE Navigator)
18483177 These findings suggest that PR plays an important antiinflammatory role in breast cancer cells via ligand-dependent and ligand-independent mechanisms.
18481002 progesterone receptor expression in malignant melanoma is inversely correlated with PCNA
18421469 Estrogenic effects on human umbilical vascular endothelial cells are mediated via the ERbeta and gestagens act via the PR-A pathway.
18394649 Adenocarcinoma of gallbladder is negative for both estrogen receptor(alpha) and progesterone receptor.
18392676 H770H and V660L and PROGINS (variant progesterone receptor complex) polymorphisms are not markers that can identify women at risk for recurrent implantation failure following in vitro fertilization and embryo transfer.
18392676 Observational study of gene-disease association. (HuGE Navigator)
18391223 luminal ER(+)PR(+) breast tumors contain a minor ER(-)PR(-)CK5(+) population that has the capacity to generate the majority of ER(+)PR(+)CK18(+)CK5(-) cells
18386458 in endometrial carcinoma Bcl-2 (B-cell lymphoma protein 2) expression was related with younger age, favorable grade and Progesterone receptor expression by tumor cells
18384825 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18378698 STAT5A and progesterone receptor are coordinately recruited to a distal enhancer of 11beta-HSD2 gene.
18375150 Positive selection provides the basis for the hypothesis that changes in structure and function of the progesterone receptor during evolution contribute to the diversity of primate reproductive biology, especially in parturition.
18321550 PR activation of extra-nuclear signaling pathways has a role in regulating selected target genes and cell cycle progression
18316616 depletion of HDAC2 results in simultaneous depletion of ER and PR, and potentiates the effects of antihormonal therapy in ER-positive cells
18313072 Thermodynamic dissection of progesterone receptor interactions at the mouse mammary tumor virus promoter.
18281038 We excluded any relationship between endometriosis in general and the P receptor +331G/A polymorphism.
18281038 Observational study of gene-disease association. (HuGE Navigator)
18276950 Carriage of +770T and +660T (but not +331T) was associated with preterm birth with body mass index <18.5 kg/m2.Carriage of minor alleles of +331(G>A), +770(C>T), and +660(G> T)SNPs in PR gene is not associated with spontaneous preterm birth.
18276950 Observational study of gene-disease association. (HuGE Navigator)
18249378 This suggests that PR-B knockdown might be responsible, at least in part, for increased proliferation and resistance to apoptosis as seen in the eutopic and ectopic endometrium of women with endometriosis.
18219286 The PROGINS variant may play a modest role in risk of endometrioid ovarian cancer.
18219286 Meta-analysis of gene-disease association. (HuGE Navigator)
18215457 The current study demonstrates that other factors known to modulate GR properties (GME, GMEB-2, Ubc9, and STAMP) can also differentially interact with PRs or alter several of the above induction parameters under otherwise identical conditions.
18197009 BRCA1 exerts its tissue-specific function through the regulation of progesterone receptor and estrogen receptor-alpha.
18189290 Results show that disease stage, tumor grade, SES, race/ethnicity, negative ER and PR status, rather than negative HER2 status, were risk factors for survival.
18184269 The positive and significant correlations between the number of CD1a+ cells and positivity of the primary tumour for estrogen receptor and progesterone receptor suggest a possible role for CD1a as a prognostic marker for breast cancer.
18096667 The regulation and function of the forkhead transcription factor, Forkhead box O1, is dependent on the progesterone receptor in endometrial carcinoma.
18048499 ERbeta/ERalpha mRNA was significantly elevated in endometriosis. Expression of PR-C mRNA relative to PR-A and PR-B mRNA was significantly increased in endometriosis.
18042733 Progesterone receptor isoforms differentially regulate expression of ABCG2 in placental choriocarcinoma cells.
17992477 Strongly positive progesterone receptor is associated with leiomyomas of uterus.
17965625 Progesterone resistance in endometriosis in general and the down regulation of PR-B, but not PR-A, in particular, are a result of promoter hypermethylation of PR-B, but not PR-A.
17958742 The PROS1 promoter is responsive to progesterone and other progestins via a mechanism involving PGR-B interacting with a progesterone response element
17951080 ER and PR are present in transverse carpal ligament and flexor tendon synovitis, suggesting a role for sex steroid hormones in the pathogenesis of carpal tunnel syndrome.
17950525 Progesterone receptor (PR) and not estrogen receptor (ER) expression is a marker for early stage breast cancer.
17919323 Observational study of gene-disease association. (HuGE Navigator)
17919323 No relation has been detected between the inflammatory and oxidative stress factors, progesterone receptor polymorphism alleles.
17914494 Tumor angiogenesis correlates with progesterone receptor (PR) status in breast carcinoma.
17896177 When progesterone receptor B was expressed, it correlated with good prognostic markers and better overall survival.
17885486 Most adult granulosa cell tumors and Sertoli-Leydig cell tumors share overlapping patterns of expression of ERalpha and PR with each other, but a subset of cases in each tumor category exhibits unique ERalpha/PR immunoprofiles
17847935 PR + tumours was higher in the older age groups
17845055 Progesterone receptor binding to DNA helps with the efficient recruitment of coactivator SRC2.
17805208 Observational study of gene-disease association. (HuGE Navigator)
17805208 Genetic variation in the progesterone receptor gene of either the mother or the fetus may trigger preterm labor.
17785366 progesterone via progesterone receptor interacts with the bcl-2 promoter to induce its expression in leiomyoma tissue
17727850 Stimulation of an epithelial-like endometriotic cell line with tumor necrosis factor alpha stimulation for 30 days induced partial methylation in the promoter region of PR-B with concomitant reduction of PR-B expression.
17717077 phosphorylated Progesterone receptor-B may be undersumoylated, transcriptionally hyperactive, and unstable/undetectable
17646097 ERbeta was 2.5-fold statistically significantly over expressed in postmenopausal leiomyomas compared to patient matched myometrium (p=0.038), whereas ERalpha and PGR were not significantly differently expressed.
17609999 Observational study of gene-disease association. (HuGE Navigator)
17609999 No assoiation demonstrated between this protein and risk of migraine-associated vertigo.
17609436 FOXO1 engages in transcriptional cross talk with progesterone receptor to coordinate cell cycle regulation and differentiation of endometrial stromal cells.
17599361 Correlation was observed between promoter methylation and loss of protein expression confirming our hypothesis that promoter methylation is an important mechanism for transcriptional silencing of these genes in breast cancer
17592773 the leucine allele of the PR V660L SNP may be associated with a small increase in breast cancer risk, while the other four PGR SNPs, +44C/T (rs518162), +331G/A (rs10895068), H770H (rs1042839) and Q886Q (rs500760), do not increase breast cancer risk
17592773 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17522428 Observational study of gene-disease association. (HuGE Navigator)
17522428 306bp Alu insertion polymorphism in intron 7 can be considered as a predisposing risk marker for breast cancer but not for endometriosis and uterine fibroids
17512111 progesterone and glucocorticoid, but not estrogen receptor mRNA are altered in breast cancer stroma
17484509 Observational study of gene-disease association. (HuGE Navigator)
17484509 progesterone receptor heterozygosis genotype frequencies were shown to be statistically higher in endometriosis cases compared with controls
17413977 This is the first report demonstrating estrogen receptors and progesterone receptors in the smooth muscle cells in smooth muscle metaplasia outside the endometriotic foci of rectovaginal endometriosis.
17316413 There was a highly significant positive association between p27(KIP-1) and estrogen receptor/progesterone receptor (ER/PR) status and with p27(KIP-1) and cyclin D1 expression. A trend between cyclin A and PR status was also identified.
17293450 PROGINS variant (V600L) is less responsive to progestin compared with the most common progesterone receptor variant.
17291258 Observational study of gene-disease association. (HuGE Navigator)
17277083 whereas both isoforms PR-A and PR-B appear to have similar DNA binding affinities, PR-B in fact has a greatly increased intrinsic binding affinity and cooperative binding ability relative to PR-A
17224149 Observational study of gene-disease association. (HuGE Navigator)
17224149 The progesterone receptor gene polymorphism factor PROGINS may be protective since it reveals reduced risk of uterine fibroids, according to PROGINS-positive genotypes in Brazilian non-white (black and mulatto) women compared to white.
17021053 focal distribution of PR within the nucleus is associated with transcription, which suggests a link between the subnuclear distribution of PR and its transcriptional activity that is likely to be important for normal cellular function of PR
17018785 Observational study of gene-disease association. (HuGE Navigator)
17006756 We showed Akt activation to significantly correlate with HER2 overexpression or LOH at the PTEN gene locus while inversely correlating with the PR expression.
16999816 Loss or absence of progesterone receptor expression is associated with endometrioid endometrial carcinoma
16985250 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16973758 a negative cross talk between PR and Stat5a/GR may contribute to the physiological role of progesterone to repress lactogenic hormone induction of the beta-casein gene
16920727 Observational study of gene-disease association. (HuGE Navigator)
16920727 PR gene polymorphic allele +331A is associated with a reduced risk of deep infiltrating endometriosis & adenomyosis compared with healthy population controls. The PROGINS polymorphism does not seem to modify the risk of deep infiltrating endometriosis.
16901007 Among the glassy cell carcinoma (GCC) cases, estrogen receptor (ER), progesterone receptor (PR) and Her2/neu were positive in 2 (18.1%), 1 (9.1%) and 5 (45.4%) cases, respectively.
16799708 The prevalence of ER, PR and HER2/neu positivity in breast cancer of Jordanian women is lower than that of the western populations and close to other populations such as the Chinese and the minor ethnic groups of Northern America (African Americans).
16772530 PR may inhibit NF-kappaB activation of COX-2 gene expression and uterine contractility via ligand-dependent and ligand-independent mechanisms.
16762974 Progesterone receptors (PR)-B and -A regulate transcription by different mechanisms.
16759928 Down-regulation of PRB in the endometrium is concomitant with the presence of glycodelin in the endometrium, suggesting interaction.
16647340 ER/PR/AR-negative cells transfected with AR were killed by DHEAS/AI treatment, providing evidence that AR is responsible for this effect. This provides the first AR-targeted hormonal therapy for ER breast cancer.
16646051 excess endogenous estrogen due to obesity contributes to an increased risk of estroge+ PR+ postmenopausal breast cancer
16614108 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16537702 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16524927 Expresssion of progesterone receptor was reduced in cultured cells compared with whole tissue.
16481409 May play a role in regulating lower segment myometrial activity during labor; whether it functions in the cervix, however, remains unclear.
16478993 GCUNC-45 is a novel modulator of progesterone receptor chaperoning by hsp90.
16477637 Observational study of gene-disease association. (HuGE Navigator)
16439457 progesterone receptor, calcitonin, and tissue tranglutaminase are involved in a signaling pathway in Ishikawa endometrial cells
16384861 BTEB1/Progesterone receptor cross-talk to facilitate progesterone dependent gene transcription in endometrial epithelial cells.
16360811 Observational study of gene-disease association. (HuGE Navigator)
16339776 No evidence of differential co-expression of the PR variants compared with wild-type PR during normal menstrual development.
16339279 up-regulation of inhibitory PR isoform expression by NF-kappaB activation in laboring fundus may inhibit PR transactivation and thereby lead to a loss of uterine quiescence and the onset of labor
16331541 There was a significant increase in the ratio of PRB to PRAB in the ampullary region compared to the fimbrial region.Progesterone may play a role in providing an appropriate environment for sperm capacitation, fertilization and early embryo cleavage.
16323958 Changing the initial subcellular localization of Pgr from the nucleus to the cytoplasm, this diminished PGR's ability to act as an inhibitor of an isoprotein of this receptor.
16244490 Meta-analysis of gene-disease association. (HuGE Navigator)
16168103 Her-2 expression was inversely related to estrogen and progesterone receptor expression in breast cancer.
16126772 Observational study of gene-disease association. (HuGE Navigator)
15996107 The 99 kDa B-isoform of the progesterone receptor undergoes self-association in the micromolar range.
15866121 results indicate that relative loss of progesterone receptor alpha during progression of endometrial cancer can have a negative impact on cadherin expression, which may lead to development of a more metastatic phenotype
15863956 progesterone receptor (PR) isoform B was equally expressed between male and female aorta, but PR-A was more abundant in female than in male aorta
15807882 Observational study of gene-disease association. (HuGE Navigator)
15798179 Function and phosphorylation of progesterone receptor are cell cycle dependent.
15797250 PPARalpha has a role in CYP4X1 regulation, and the glucocorticoid and progesterone receptors have roles in CYP4Z1 gene activation
15743833 Active displacement of PR from the MMTV promoter during chromatin remodeling in vitro and in vivo is ligand specific, and factor displacement is an important component of receptor mobility.
15728178 the effect of estrogen is markedly disrupted by estrogen-independent expression of progesterone receptor in breast cancer cells
15718480 Observational study of gene-disease association. (HuGE Navigator)
15698546 Observational study of gene-disease association. (HuGE Navigator)
15654614 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15654614 PR genes in migraine with the 594A variant showed that individuals who possessed at least one copy of both risk alleles were 3.2 times more likely to suffer migraine.
15632380 Observational study of gene-disease association. (HuGE Navigator)
15632380 Variation in PGR was associated with higher ovarian cancer risk, the same variation was associated with a reduced risk of breast cancer, but the association was not statistically significant.
15613410 ER-beta and PR mRNA expressed by endometrial endothelial cells is differentially regulated by treatment with estrogen or progestin.
15607534 Loss of progesterone receptors is associated with prostatic tumors
15601848 cyclin A/Cdk2 has a role as a progesterone receptor coactivator
15598772 Observational study of gene-disease association. (HuGE Navigator)
15579801 Increased transcriptional activity was due to increased stability resulting in higher expression of mutant progesterone receptor. May participate in ovarian carcinogenesis.
15572421 Effects of the progesterone receptor modulator CDB-2914 on proliferative activity and apoptosis in cultured human uterine leiomyoma cells.
15563544 PR-A:PR-B ratios, even in the absence of progesterone, influence the biology and treatment response of estrogen receptor+ tumors; and PR-A isoforms are functionally dominant in P-deficient states and have a role in tumor aggressiveness
15562029 isoform p4 is a potent regulator of GnRHRI at the transcriptional level as well as GnRH I mRNA.
15555905 expressions of both isoforms A and B significantly correlated with biologically malignant potential - esp endometrial
15535845 Observational study of gene-disease association. (HuGE Navigator)
15509639 PR-A and PR-B are expressed in germ cells of human testis in a stage-specific manner.
15381922 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15330195 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15282324 Data show that CCND1 promoter activation by estrogens in human breast cancer cells is mediated by recruitment of a c-Jun/c-Fos/estrogen receptor alpha/progesterone receptor complex to the tetradecanoyl phorbol acetate-responsive element of the gene.
15272917 Observational study of gene-disease association. (HuGE Navigator)
15272913 Observational study of gene-disease association. (HuGE Navigator)
15219637 Observational study of gene-disease association. (HuGE Navigator)
15219637 Data suggest that the G331A polymorphism in the progesterone receptor gene may influence the risk for panic disorder in women.
15184270 Finds no association between the PGR +331G/A single nucleotide polymorphism and breast cancer.
15171716 Data show that in myometrial cells, progesterone receptor B exhibits strong progesterone-dependent transcriptional activity that is dependent on the presence of two LXXLL motifs within the AF3 domain.
15102680 progesterone receptor PR-A has a role in progression of breast neoplasms
15084345 expression is controlled by estrogen receptor alpha and estradiol
15084343 examination of regulation by estrogen response element half site and Sp1 sites
15036714 Observational study of gene-disease association. (HuGE Navigator)
15001645 In endometrial cancers colocalization of PRA and PRB was infrequent, and there was no relationship between even and focal PR isoform distribution, unlike the normal endometrium
14978266 Molecular chaperone involvement in steroid receptor subnuclear trafficking provided by the ATP-dependent recovery of nuclear mobility of glucorticoid and progesterone receptors.
14769635 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
14764828 prostaglandins acting via protein kinase C pathway facilitate functional progesterone withdrawal by increasing the myometrial progesterone receptor-A and -B expression ratio
14684847 human PR gene is regulated by multiple transcription factors and that the differential binding of these dynamically regulated trans-acting factors influences gene expression.
14667967 selective contribution of the two PR isoforms to progesterone action
14667966 Progesterone receptor transcription and non-transcription signaling mechanisms [review]
14634838 Observational study of genotype prevalence. (HuGE Navigator)
14617569 glucocorticoid and mineralocorticoid cross-talk with PR to produce progesterone-like effects in breast cancer cells
14586360 Observational study of gene-disease association. (HuGE Navigator)
14557830 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14551264 A novel protein-mediated activity in rabbit reticulocyte lysates is required in an additional, heretofore unrecognized, activation step required for PR to become transcriptionally competent on chromatin templates.
14519645 Loss of PR expression in human endometrial cancer may lead to development of a more invasive phenotype of the respective tumor.
14500352 Observational study of gene-disease association. (HuGE Navigator)
12943706 Two isoforms of this protein stabilize active receptor conformers within an ensemble distribution of active and inactive conformational states.
12899921 Progesterone receptor promoter methylation may be a molecular marker in various cancer detections.
12861133 malignant ovarian epithelial cells demonstrated multiple alterations in the expression of estrogen receptor-alpha, estrogen receptor-beta, progesterone receptor A, and progesterone receptor B
12771131 that SMRT and DAX-1 repress agonist-dependent activity of progesterone receptors
12759236 Results provided in vitro evidence of the close association of progesterone receptor with differentiation in breast cancer.
12748280 Data show that differential recruitment of coactivators by progesterone and glucocorticoid receptors determines the assembly of coactivator complexes on target promoters to mediate specific transcription signals.
12699057 lack of progesterone receptor in breast cancer is associated with aneuploidy and median S-phase fraction
12673676 Novel alternatively spliced variant with a deletion of 52 base pairs in exon 6 of the progesterone receptor is associated with breast cancer
12672823 PR-A and PR-B have a role in progesterone-dependent gene transcription in the uterus involving select KLF members
12650698 analysis of isoforms of progesterone receptor
12644308 Cloning and expression of a new truncated, progesterone receptor.
12612073 2 domains of PRB, ERID-I and -II, mediate a direct interaction with the ligand-binding domain of ERalpha. ERID-I and ERID-II flank a proline cluster responsible for binding of PRB to c-Src.
12594000 Estrogen receptor and progesterone receptor concentrations and ERalpha transcription levels were not statistically different between ethnic backgrounds.A causative role for these receptors in the ethnic variation of leiomyoma seems unlikely
12556966 small, hormone-receptor-positive breast cancers (with a theoretical good prognosis) may carry an elevated risk of nodal involvement if accumulation of uPA-PAI-1 complexes is shown inside their tumour cells by means of immunohistochemistry.
12554776 a regulatory role for MAPK in nuclear steroid hormone receptor subcellular localization
12554765 low PR status may serve as an indicator of activated growth factor signaling in breast tumor cells, and therefore of an aggressive tumor phenotype and resistance against hormonal therapy
12529333 Sumoylation was shown to increase progesterone receptor-SRC-1 interaction
12517594 model to study functional differences between progesterone receptors A and B isoforms in human endometrial carcinoma cells revealed distinctive differences in target gene regulation between the two
12446585 studies suggest that the cooperative interaction of the estrogen receptor with Fos and Jun proteins helps confer estrogen responsiveness to the endogenous progesterone receptor gene
12414909 progesterone may be involved in regulation of the growth and development of neurogenic tumors via progesterone receptor
12402980 Progesterone receptor mRNA variant containing novel exon insertions between exon 4 and exon 5 in human uterine endometrium. The i45 PR mRNA variant was detected in uterine endometrial cancer and in normal endometrium.
12297552 significantly higher percentage of spermatozoa with physiologically active plasma membrane lacked progesterone receptor expression in all categories of men with infertility
12218173 Observational study of gene-disease association. (HuGE Navigator)
12218173 statistically significant association between the +331G/A polymorphism and the risk of endometrial cancer
12149147 down-regulation of PRA is associated with the development of ovarian epithelial carcinoma
12114521 conclude that autoinhibition and transrepression involve N-terminal sumoylation combined with intramolecular N/C-terminal communication
12113882 decrease in estrogen receptor alpha and progesterone receptor A and B concentration in the early phase of first stage labor may play a role in cervical dilation at term
12090595 appears to be uniformly expressed in leiomyomatosis peritonealis disseminata (LPD)nodules from premenopausal and postmenopausal women, supporting the contention that hormones influence the development of LPD in all cases, regardless of menopausal status
12088866 Progesterone receptor activates its promoter activity thru an active Sp1 site in human endometrial stromal cells. hPRA capability was stronger than hPRB. The ligand binding domain, but not DNA-binding domain, of hPR was required for transactivation.
12048256 Coactivator/corepressor ratios modulate progesteronse receptor-mediated transcription by RU486
12038703 Observational study of gene-disease association. (HuGE Navigator)
12021930 consistent occurrence of progesterone-receptor immunoreactivity in meningothelioid nodules detected in surgical specimens of lung carcinomas
12021276 New human breast cancer cells to study isoform ratio effects and ligand-independent gene regulation.
12010857 Observational study of gene-disease association. (HuGE Navigator)
12010857 The polymorphism of the progesterone receptor (PR) is not associated with a reduced or increased risk of breast cancer. However, this study cannot exclude a small reduced or increased risk associated with the T allele, especially the rare TT genotype.
12009358 May be an important finding in attempting to characterize both the molecular etiology of implantation and the molecular pathophysiology of spontaneous abortion.
11948021 cloning and genomic organization
11918216 these results show that although estrogen can up-regulate endogenous PR gene expression in osteoblasts via both ER isoforms, ER-alpha is the predominant inducer.
11821088 Observational study of gene-disease association. (HuGE Navigator)
11717311 isoform-specific genes can be used to screen for ligands that selectively modulate the activity of PR-A or PR-B
11677150 Observational study of gene-disease association. (HuGE Navigator)
11668524 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11668223 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11326686 Observational study of genotype prevalence, gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11323389 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPS      1 - 70
DEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSW     71 - 140
CLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPV    141 - 210
KPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRV    211 - 280
ALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASS    281 - 350
TPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG    351 - 420
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLL    421 - 490
PRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSEASQSPQYSFE    491 - 560
SLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQA    561 - 630
GMVLGGRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIY    631 - 700
AGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKH    701 - 770
VSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ    771 - 840
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMS    841 - 910
EVIAAQLPKILAGMVKPLLFHKK                                                   911 - 933
//

Text Mined References (614)

PMID Year Title
27069179 2016 Neural Analyses Validate and Emphasize the Role of Progesterone Receptor in Breast Cancer Progression and Prognosis.
26916548 2016 Progesterone acts via the progesterone receptor to induce adamts proteases in ovarian cancer cells.
26892043 2016 Progesterone receptor (PR) polyproline domain (PPD) mediates inhibition of epidermal growth factor receptor (EGFR) signaling in non-small cell lung cancer cells.
26829108 2016 Estrogen-Receptor, Progesterone-Receptor and HER2 Status Determination in Invasive Breast Cancer. Concordance between Immuno-Histochemistry and MapQuant™ Microarray Based Assay.
26820652 2016 Discordant assessment of tumor biomarkers by histopathological and molecular assays in the EORTC randomized controlled 10041/BIG 03-04 MINDACT trial breast cancer : Intratumoral heterogeneity and DCIS or normal tissue components are unlikely to be the cause of discordance.
26579819 2015 Prognostic Significance of Single Progesterone Receptor Positivity: A Comparison Study of Estrogen Receptor Negative/Progesterone Receptor Positive/Her2 Negative Primary Breast Cancer With Triple Negative Breast Cancer.
26577046 2016 Active FOXO1 Is a Key Determinant of Isoform-Specific Progesterone Receptor Transactivation and Senescence Programming.
26550991 2015 DNA Methylation Patterns Can Estimate Nonequivalent Outcomes of Breast Cancer with the Same Receptor Subtypes.
26517007 2016 Can membrane progesterone receptor ? on T regulatory cells explain the ensuing human labour?
26458823 2015 Hormone-related pathways and risk of breast cancer subtypes in African American women.
26428028 2015 Molecular profiling of estrogen receptor ? and progesterone receptor transcript variants in endometrial cancer.
26403396 CORRELATION BETWEEN CLINICAL PATHOLOGY OF LUMINAL B BREAST CANCER AND DETERMINATION OF ESTROGEN RECEPTOR, PROGESTERONE RECEPTOR AND HER2 EXPRESSION COMBINED WITH NUCLEAR MORPHOLOGY.
26387168 2015 [SINGLE NUCLEOTIDE POLYMORPHISMS IN HUMAN PROGESTERONE RECEPTOR GENE AND ITS VALUE IN MISCARRIAGE OR PRETERM DELIVERY].
26340407 2015 Heregulin Co-opts PR Transcriptional Action Via Stat3 Role As a Coregulator to Drive Cancer Growth.
26286601 2015 Progesterone Receptor (PGR) gene polymorphism is associated with susceptibility to preterm birth.
26261614 2015 Diagnostic value of progesterone receptor, p16, p53 and pHH3 expression in uterine atypical leiomyoma.
26260940 2016 Influence of Hormone Receptor Status on Spinal Metastatic Lesions in Patients with Breast Cancer.
26252518 2015 Endometrial Endometrioid Carcinoma Metastases Show Decreased ER-Alpha and PR-A Expression Compared to Matched Primary Tumors.
26161666 2015 Outcomes of Estrogen Receptor Negative and Progesterone Receptor Positive Breast Cancer.
26160085 2015 Evaluation of Hormone Receptor Status (ER/PR/HER2-neu) in Breast Cancer in Pakistan.
26153859 2015 Progesterone receptor modulates ER? action in breast cancer.
26053183 2015 Progesterone receptor loss identifies luminal-type local advanced breast cancer with poor survival in patients who fail to achieve a pathological complete response to neoadjuvant chemotherapy.
26037298 2015 Abundance and Localization of Progesterone Receptor Isoforms in Endometrium in Women With and Without Endometriosis and in Peritoneal and Ovarian Endometriotic Implants.
26036714 2015 Expression of gonadal steroid receptors in the ovaries of post-menopausal women with malignant or benign endometrial pathology: a pilot study.
26006736 2015 Increased progesterone receptor expression in uterine leiomyoma: correlation with age, number of leiomyomas, and clinical symptoms.
25908555 2015 Defining breast cancer intrinsic subtypes by quantitative receptor expression.
25894978 2015 The chromatin Remodeler CHD8 is required for activation of progesterone receptor-dependent enhancers.
25875046 2015 Roles of progesterone receptor A and B isoforms during human endometrial decidualization.
25845386 2015 Mitochondrial DNA alterations correlate with the pathological status and the immunological ER, PR, HER-2/neu, p53 and Ki-67 expression in breast invasive ductal carcinoma.
25833156 2015 Progesterone receptor expression during prostate cancer progression suggests a role of this receptor in stromal cell differentiation.
25802405 2015 Breast cancer with brain metastases: clinicopathologic features, survival, and paired biomarker analysis.
25778295 Neoadjuvant chemotherapy-induced changes in immunohistochemical expression of estrogen receptor, progesterone receptor, HER2, and Ki-67 in patients with breast cancer.
25778292 Progesterone receptor status in determining the prognosis of estrogen receptor positive/ HER2 negative breast carcinoma patients.
25723513 2015 High progesterone receptor expression in prostate cancer is associated with clinical failure.
25603724 2015 Estrogen and progesterone receptor subtype expression in granulosa cells from women with polycystic ovary syndrome.
25600243 2015 High Ki-67 Expression and Low Progesterone Receptor Expression Could Independently Lead to a Worse Prognosis for Postmenopausal Patients With Estrogen Receptor-Positive and HER2-Negative Breast Cancer.
25595111 2015 Intranuclear expression of progesterone receptors in smooth muscle cells of renovascular fibromuscular dysplasia: a pilot study.
25584414 2015 FOXO1 is required for binding of PR on IRF4, novel transcriptional regulator of endometrial stromal decidualization.
25494303 2015 Progesterone receptor gene (PROGINS) polymorphism correlates with late onset of migraine.
25439299 2015 Gene and protein expression of oestrogen-? and progesterone receptors in facial melasma and adjacent healthy skin in women.
25385317 2016 Increased Igf-I/Igfbp-3 Ratios in Postmenopausal Taiwanese with Breast Cancer, Irrespective of Er and Pr Statuses and Her2 Expression in a Case-Control Study.
25353185 2015 Progesterone receptor-NF?B complex formation is required for progesterone-induced NF?B nuclear translocation and binding onto the p53 promoter.
25338681 2014 Integrative investigation on breast cancer in ER, PR and HER2-defined subgroups using mRNA and miRNA expression profiling.
25337220 2014 Evaluation of BrightGen HR RT-qDx assay to detect nuclear receptors mRNA overexpression in FFPE breast cancer tissue samples for selection of tamoxifen therapy.
25281525 2014 Loss of progesterone receptor links to high proliferation and increases from primary to metastatic endometrial cancer lesions.
25261374 2014 Acquired convergence of hormone signaling in breast cancer: ER and PR transition from functionally distinct in normal breast to predictors of metastatic disease.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25228088 2015 Polymorphisms of progesterone receptor and ovarian cancer risk: a systemic review and meta-analysis.
25217304 2015 The relationship among HOXA10, estrogen receptor ?, progesterone receptor, and progesterone receptor B proteins in rectosigmoid endometriosis: a tissue microarray study.
25216078 2014 A novel functional interplay between Progesterone Receptor-B and PTEN, via AKT, modulates autophagy in breast cancer cells.
25170613 2014 Progesterone receptor status and Ki-67 index may predict early relapse in luminal B/HER2 negative breast cancer patients: a retrospective study.
25155819 2015 Decreased expression of mucin-1 in endometriosis endometrium correlated with progesterone receptor B involved in infertility.
25076292 2014 Progesterone receptor and PTEN expression predict survival in patients with low- and intermediate-grade pancreatic neuroendocrine tumors.
25037596 2015 Association of the +331G/A progesterone receptor gene (PgR) polymorphism with risk of endometrial cancer in Caucasian women: a meta-analysis.
25015900 2015 Progesterone receptor B promoter hypermethylation in human placenta after labor onset.
24992175 2015 Oncotype DX RT-qPCR assay for ER and PR correlation with IHC: a study of 3 different clones.
24945100 2015 Levels of oestrogen receptor, progesterone receptor and ?B-crystallin in eutopic endometrium in relation to pregnancy in women with endometriosis.
24943061 2014 Association of the progesterone receptor gene polymorphism (PROGINS) with endometriosis: a meta-analysis.
24909783 2014 Influence of domain interactions on conformational mobility of the progesterone receptor detected by hydrogen/deuterium exchange mass spectrometry.
24894997 2014 Expression and cellular localization of the classical progesterone receptor in healthy and amyotrophic lateral sclerosis affected spinal cord.
24851606 2014 A correlation between the expression of estrogen receptors and progesterone receptors in cancer cells and in the myometrium and prognostic factors in endometrial cancer.
24815444 2014 ESR1 and PGR gene promoter methylation and correlations with estrogen and progesterone receptors in ductal and lobular breast cancer.
24785095 2014 OPG and PgR show similar cohort specific effects as prognostic factors in ER positive breast cancer.
24684970 2014 Distribution of estrogen and progesterone receptors isoforms in endometrial cancer.
24667714 2014 High concordance of protein (by IHC), gene (by FISH; HER2 only), and microarray readout (by TargetPrint) of ER, PgR, and HER2: results from the EORTC 10041/BIG 03-04 MINDACT trial.
24664419 2014 Prostate stromal cells express the progesterone receptor to control cancer cell mobility.
24606123 2014 Progesterone receptor-cyclin D1 complexes induce cell cycle-dependent transcriptional programs in breast cancer cells.
24570392 2014 In pulmonary lymphangioleiomyomatosis expression of progesterone receptor is frequently higher than that of estrogen receptor.
24549642 2014 Differential expression of progesterone receptor, FOXA1, GATA3, and p53 between pre- and postmenopausal women with estrogen receptor-positive breast cancer.
24531693 2014 Chromatin composition alterations and the critical role of MeCP2 for epigenetic silencing of progesterone receptor-B gene in endometrial cancers.
24481237 2014 DNA methylation patterns of steroid receptor genes ESR1, ESR2 and PGR in deep endometriosis compromising the rectum.
24469035 2015 Progesterone receptor-B enhances estrogen responsiveness of breast cancer cells via scaffolding PELP1- and estrogen receptor-containing transcription complexes.
24442343 2014 Increased progesterone receptor A expression in labouring human myometrium is associated with decreased promoter occupancy by the histone demethylase JARID1A.
24423317 2014 Expression of a mitochondrial progesterone receptor (PR-M) in leiomyomata and association with increased mitochondrial membrane potential.
24415758 2014 Lysine methylation of progesterone receptor at activation function 1 regulates both ligand-independent activity and ligand sensitivity of the receptor.
24401087 2014 Integrity of the LXXLL motif in Stat6 is required for the inhibition of breast cancer cell growth and enhancement of differentiation in the context of progesterone.
24398991 2013 Estrogen and progesterone receptor expression in the mammary gland tumors.
24345432 2013 Progesterone receptor assembly of a transcriptional complex along with activator protein 1, signal transducer and activator of transcription 3 and ErbB-2 governs breast cancer growth and predicts response to endocrine therapy.
24322014 2013 Cutaneous metastases from breast carcinoma: calretinin expression and estrogen, progesterone and Her2/neu status of the metastases, compared to primary cutaneous apocrine tumors.
24302725 2014 Acetylation at lysine 183 of progesterone receptor by p300 accelerates DNA binding kinetics and transactivation of direct target genes.
24300977 2014 Progesterone receptor expression is an independent prognostic variable in early breast cancer: a population-based study.
24276461 2014 Negative effects of progesterone receptor isoform-A on human placental activity of the noncanonical NF-?B signaling.
24269135 2014 A meta-analysis of oestrogen receptor, progesterone receptor and human epidermal growth factor receptor 2 discordance between primary breast cancer and metastases.
24245695 2013 No direct nuclear effect of progesterone in the inner ear: other possible pathways.
24225150 2014 Expression of kisspeptin/GPR54 and PIBF/PR in the first trimester trophoblast and decidua of women with recurrent spontaneous abortion.
24197980 2014 Progesterone receptor PROGINS and +331G/A polymorphisms confer susceptibility to ovarian cancer: a meta-analysis based on 17 studies.
24162264 The characteristics of breast cancer subtypes: implications for treatment guidelines and individualized treatment strategies in China.
24114857 2013 Discordance in ER?, PR and HER2 receptor status across different distant breast cancer metastases within the same patient.
24057181 2013 Analyze association of the progesterone receptor gene polymorphism PROGINS with ovarian cancer risk.
24051696 2014 Distinguishing luminal breast cancer subtypes by Ki67, progesterone receptor or TP53 status provides prognostic information.
24036907 2013 Serum epidermal growth factor is associated with prognosis and hormone receptor status in patients with HER2-positive metastatic breast cancer treated with first-line trastuzumab plus taxane chemotherapy.
24021827 [The expression assessment of the estrogen, progesterone and HER2 receptors in selected malignant tumors of the salivary glands].
23995840 2013 Regulation of the structurally dynamic N-terminal domain of progesterone receptor by protein-induced folding.
23977306 2013 Assessing interactions between the association of common genetic variant at 1p11 (rs11249433) and hormone receptor status with breast cancer risk.
23970345 2013 Progesterone protects ovarian cancer cells from cisplatin-induced inhibitory effects through progesterone receptor membrane component 1/2 as well as AKT signaling.
23934021 2013 Association of progesterone receptor gene polymorphism with male infertility and clinical outcome of ICSI.
23907837 Gene x environment interactions impact endometrial function and the menstrual cycle: PROGINS, life history, anthropometry, and physical activity.
23881388 2013 TIMP1 overexpression mediates resistance of MCF-7 human breast cancer cells to fulvestrant and down-regulates progesterone receptor expression.
23880761 2013 Progesterone receptor A stability is mediated by glycogen synthase kinase-3? in the Brca1-deficient mammary gland.
23873108 2013 Regulation of BMI1 Polycomb gene expression in histological grades of invasive ductal breast carcinomas and its correlation with hormone receptor status.
23859042 2013 Effects of phytoestrogen extracts isolated from pumpkin seeds on estradiol production and ER/PR expression in breast cancer and trophoblast tumor cells.
23818363 Expression of hPEBP4 negatively correlates with estrogen and progesterone receptors in endometrial carcinoma.
23818347 Evaluation of changes in biologic markers ER, PR, HER 2 and Ki-67 index in breast cancer with administration of neoadjuvant dose dense doxorubicin, cyclophosphamide followed by paclitaxel chemotherapy.
23818346 Prognostic significance of estrogen receptor, progesterone receptor, HER2/neu, Ki-67, and nm23 expression in patients with invasive breast cancer.
23812730 2013 HtrA3 is negatively correlated with lymph node metastasis in invasive ductal breast cancer.
23810009 2013 Role of KLF5 in hormonal signaling and breast cancer development.
23764995 2013 Association of progesterone receptor gene (PGR) variants and breast cancer risk in African American women.
23757214 2014 Association of estrogen receptor, progesterone receptor and HER2 following neoadjuvant systemic treatment in breast cancer patients undergoing surgery.
23723333 2013 Discordances in estrogen receptor status, progesterone receptor status, and HER2 status between primary breast cancer and metastasis.
23706170 2013 Coordinate patterns of estrogen receptor, progesterone receptor, and Wilms tumor 1 expression in the histopathologic distinction of ovarian from endometrial serous adenocarcinomas.
23699411 2013 Unliganded progesterone receptor-mediated targeting of an RNA-containing repressive complex silences a subset of hormone-inducible genes.
23687977 2013 Expressions of candidate molecules in the human fallopian tube and chorionic villi of tubal pregnancy exposed to levonorgestrel emergency contraception.
23668054 2013 [The value of progesterone and estrogen receptors expression in tissue microarray method in prognosis of patients with endometrioid endometrial cancer].
23666965 2013 Expression and function of the progesterone receptor in human prostate stroma provide novel insights to cell proliferation control.
23603247 2013 The PRB-dependent FOXO1/IGFBP-1 axis is essential for progestin to inhibit endometrial epithelial growth.
23574718 2013 Progesterone receptors induce FOXO1-dependent senescence in ovarian cancer cells.
23570281 2013 ER+ /PR+ /TFF3+ /IMP3- immunoprofile distinguishes endometrioid from serous and clear cell carcinomas of the endometrium: a study of 401 cases.
23558572 2013 Intrinsic breast cancer subtypes defined by estrogen receptor signalling-prognostic relevance of progesterone receptor loss.
23518922 2013 A truncated progesterone receptor (PR-M) localizes to the mitochondrion and controls cellular respiration.
23506845 2013 Reduced expression of 15-hydroxy prostaglandin dehydrogenase in chorion during labor is associated with decreased PRB and increased PRA and GR expression.
23490124 2013 The expression of estrogen and progesterone receptors in the human larynx.
23485561 2013 Progesterone receptor isoforms PRA and PRB differentially contribute to breast cancer cell migration through interaction with focal adhesion kinase complexes.
23474171 2013 The role of DNA methylation and histone acetylation in the regulation of progesterone receptor isoforms expression in human astrocytoma cell lines.
23397283 2013 The detection of ESR1/PGR/ERBB2 mRNA levels by RT-QPCR: a better approach for subtyping breast cancer and predicting prognosis.
23349706 2013 Association of +331G/A PgR polymorphism with susceptibility to female reproductive cancer: evidence from a meta-analysis.
23339407 2013 RhoB modifies estrogen responses in breast cancer cells by influencing expression of the estrogen receptor.
23307470 2013 WNT10B/?-catenin signalling induces HMGA2 and proliferation in metastatic triple-negative breast cancer.
23222299 2012 Obesity and overfeeding affecting both tumor and systemic metabolism activates the progesterone receptor to contribute to postmenopausal breast cancer.
23209664 2012 Progesterone acts via the nuclear glucocorticoid receptor to suppress IL-1?-induced COX-2 expression in human term myometrial cells.
23199240 2012 Expression profile and prognostic role of sex hormone receptors in gastric cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23177737 2013 Nucleosome-driven transcription factor binding and gene regulation.
23060300 2013 Impact of progesterone receptor semiquantitative immunohistochemical result on Oncotype DX recurrence score: a quality assurance study of 1074 cases.
23029355 2012 Differential regulation of breast cancer-associated genes by progesterone receptor isoforms PRA and PRB in a new bi-inducible breast cancer cell line.
23022996 2013 Progesterone receptor loss identifies Luminal B breast cancer subgroups at higher risk of relapse.
23018797 2013 Polymorphisms in the fetal progesterone receptor and a calcium-activated potassium channel isoform are associated with preterm birth in an Argentinian population.
22972951 2012 Prediction of breast cancer risk by genetic risk factors, overall and by hormone receptor status.
22808109 2012 Significant role of estrogen and progesterone receptor sequence variants in gallbladder cancer predisposition: a multi-analytical strategy.
22727345 2012 Biomarkers of progestin therapy resistance and endometrial hyperplasia progression.
22722322 2012 Progesterone receptor variants associated with the PROGINS haplotype exhibit functional properties similar to those of wild-type progesterone receptor.
22697792 2012 Phosphorylated and sumoylation-deficient progesterone receptors drive proliferative gene signatures during breast cancer progression.
22633539 2012 Selected polymorphisms in sex hormone-related genes, circulating sex hormones and risk of endometrial cancer.
22613790 2012 Association of endometriosis risk and genetic polymorphisms involving biosynthesis of sex steroids and their receptors: an updating meta-analysis.
22590818 2012 Hormone receptors expression in phyllodes tumors of the breast.
22580007 2012 Progesterone and estrogen receptors segregate into different cell subpopulations in the normal human breast.
22564243 2012 Caveolin-1 interferes cell growth of lung cancer NCI-H446 cell through the interactions with phospho-ERK1/2, estrogen receptor and progestin receptor.
22545144 2012 Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.
22535964 2012 X-ray structures of progesterone receptor ligand binding domain in its agonist state reveal differing mechanisms for mixed profiles of 11?-substituted steroids.
22529366 2012 MicroRNA-200a serves a key role in the decline of progesterone receptor function leading to term and preterm labor.
22509838 2012 Selected variants of the steroid-5-alpha-reductase isoforms SRD5A1 and SRD5A2 and the sex steroid hormone receptors ESR1, ESR2 and PGR: no association with female pattern hair loss identified.
22496908 2012 Membrane progesterone receptor alpha as a potential prognostic biomarker for breast cancer survival: a retrospective study.
22492871 2012 Endometrial miR-181a and miR-98 expression is altered during transition from normal into cancerous state and target PGR, PGRMC1, CYP19A1, DDX3X, and TIMP3.
22466340 2012 Transforming growth factor ?1 (TGF?1) and progesterone regulate matrix metalloproteinases (MMP) in human endometrial stromal cells.
22419721 2012 Progesterone receptor-A and -B have opposite effects on proinflammatory gene expression in human myometrial cells: implications for progesterone actions in human pregnancy and parturition.
22414972 2012 Factors influencing the hormone receptor and HER2 levels in breast cancer: a population-based analysis.
22394363 2012 EGFR overexpression relates to triple negative profile and poor prognosis in breast cancer patients in Tunisia.
22369759 2012 Term myometrium is characterized by increased activating epigenetic modifications at the progesterone receptor-A promoter.
22329840 2012 Evaluation of 14-3-3 protein family levels and associated receptor expression of estrogen and progesterone in human uterine leiomyomas.
22290394 2012 Comparison of ER/PR and HER2 statuses in primary and paired liver metastatic sites of breast carcinoma in patients with or without treatment.
22281037 2012 Transient expression of progesterone receptor and cathepsin-l in human granulosa cells during the periovulatory period.
22217299 2012 Diagnostic value of progesterone receptor and p53 expression in uterine smooth muscle tumors.
22203942 2011 Immunohistochemical evaluation of hormone receptors with predictive value in mammary carcinomas.
22201220 2012 Thermodynamic dissection of estrogen receptor-promoter interactions reveals that steroid receptors differentially partition their self-association and promoter binding energetics.
22199306 2011 Loss of p27KIP1 expression in fully-staged node-negative breast cancer: association with lack of hormone receptors in T1a/b, but not T1c infiltrative ductal carcinoma.
22119825 2011 Ductal invasive mammary carcinoma--clinicopathological prognostic factors related to immunohistochemical expression of hormonal receptors and Her2/neu oncoprotein.
22107784 2011 The prognostic impact of Akt isoforms, PI3K and PTEN related to female steroid hormone receptors in soft tissue sarcomas.
22105149 2012 Progestogen levels, progesterone receptor gene polymorphisms, and mammographic density changes: results from the Postmenopausal Estrogen/Progestin Interventions Mammographic Density Study.
22102068 2011 Analysis of PTEN, estrogen receptor ? and progesterone receptor expression in endometrial hyperplasia using tissue microarray.
22093824 2011 5'-AMP-activated protein kinase (AMPK) regulates progesterone receptor transcriptional activity in breast cancer cells.
22092403 2011 Evaluation of a hormone receptor-positive ovarian carcinoma subtype with a favourable prognosis by determination of progesterone receptor and oestrogen receptor 1 mRNA expression in formalin-fixed paraffin-embedded tissue.
22057681 2012 The expression of PCNA, c-erbB-2, p53, ER and PR as well as atypical hyperplasia in tissues nearby the breast cancer.
22047608 2012 Tumor necrosis factor (TNF)-? upregulates progesterone receptor-A by activating the NF-?B signaling pathway in human decidua after labor onset.
22031296 2012 DHHC-7 and -21 are palmitoylacyltransferases for sex steroid receptors.
22022496 2011 Hormone receptor and ERBB2 status in gene expression profiles of human breast tumor samples.
22004841 2011 Changes in the ER, PgR, HER2, p53 and Ki-67 biological markers between primary and recurrent breast cancer: discordance rates and prognosis.
21980607 2011 Differential expression of estrogen and progesterone receptors in endometrial polyps and adjacent endometrium in postmenopausal women.
21901395 2012 Triple-negative phenotype is of adverse prognostic value in patients treated with dose-dense sequential adjuvant chemotherapy: a translational research analysis in the context of a Hellenic Cooperative Oncology Group (HeCOG) randomized phase III trial.
21877015 2011 [The progesterone receptor gene polymorphism as factor of risk for the preterm delivery].
21840910 2011 Expression patterns of Aurora A and B kinases, Ki-67 and the estrogen and progesterone receptors determined using an endometriosis tissue microarray model.
21840784 2011 Cyclooxygenase-2 immunoexpression in breast cancer: progesterone receptor influence.
21816898 2011 p38 and p42/44 MAPKs differentially regulate progesterone receptor A and B isoform stabilization.
21815951 2011 Differential and interactive effects of ligand-bound progesterone receptor A and B isoforms on tyrosine hydroxylase promoter activity.
21764500 2011 Combination of polymorphisms in luteinizing hormone ?, estrogen receptor ? and progesterone receptor and susceptibility to infertility and endometriosis.
21762477 2011 Nottingham Prognostic Index in triple-negative breast cancer: a reliable prognostic tool?
21751163 2011 Polymorphism of the progesterone receptor gene associated with endometriosis in patients from Goiás, Brazil.
21749714 2011 Distinct distribution and prognostic significance of molecular subtypes of breast cancer in Chinese women: a population-based cohort study.
21736840 2011 Dietary folate, vitamin B6, vitamin B12 and methionine intake and the risk of breast cancer by oestrogen and progesterone receptor status.
21700456 2011 Estrogen receptor positive operable breast cancer: does menopausal status impact on HER2 and progesterone receptor status?
21695196 2011 Subtype specific elevated expression of hyaluronidase-1 (HYAL-1) in epithelial ovarian cancer.
21655654 2011 Endometrial carcinomas: correlation between ER, PR, Ki67 status and histopathological prognostic parameters.
21619605 2011 Antiprogestin mifepristone inhibits the growth of cancer cells of reproductive and non-reproductive origin regardless of progesterone receptor expression.
21600232 2011 Progesterone and estrogen receptor expression and activity in human non-small cell lung cancer.
21544804 2012 Serum enterolactone and postmenopausal breast cancer risk by estrogen, progesterone and herceptin 2 receptor status.
21518957 2011 ck2-dependent phosphorylation of progesterone receptors (PR) on Ser81 regulates PR-B isoform-specific target gene expression in breast cancer cells.
21491087 2011 Estrogen and progesterone receptor expression in HPV-positive and HPV-negative cervical carcinomas.
21464042 2011 Interaction between FGFR-2, STAT5, and progesterone receptors in breast cancer.
21459801 2011 Progesterone receptor isoform-specific promoter methylation: association of PRA promoter methylation with worse outcome in breast cancer patients.
21447625 2011 Four enzymes cooperate to displace histone H1 during the first minute of hormonal gene activation.
21444077 2011 Estrogen and progesterone receptor isoform distribution through the menstrual cycle in uteri with and without adenomyosis.
21437249 2011 Multiple cancer/testis antigens are preferentially expressed in hormone-receptor negative and high-grade breast cancers.
21432776 2011 Low expression of progesterone receptor A in intermediate trophoblast of miscarriages.
21422407 2011 Estrogen receptor and progesterone receptor as predictive biomarkers of response to endocrine therapy: a prospectively powered pathology study in the Tamoxifen and Exemestane Adjuvant Multinational trial.
21397694 2011 Novel estrogen-related genes and potential biomarkers of ovarian endometriosis identified by differential expression analysis.
21340479 2012 Unliganded progesterone receptors attenuate taxane-induced breast cancer cell death by modulating the spindle assembly checkpoint.
21271213 2011 Estrogen receptor and progesterone receptor are prognostic factors in soft tissue sarcomas.
21269613 2011 Does advanced-stage endometriosis affect the gene expression of estrogen and progesterone receptors in granulosa cells?
21243274 2010 The progins progesterone receptor gene polymorphism is not related to endometriosis-associated infertility or to idiopathic infertility.
21184768 2011 Novel role of signal transducer and activator of transcription 3 as a progesterone receptor coactivator in breast cancer.
21184272 2011 Evaluation of estrogen and progesterone receptors in non-neoplastic breast tissue of women of reproductive age exposed to tamoxifen and raloxifene: a randomized, double-blind study.
21152841 2010 [Endometrial polyps: clinical and epidemiological aspects and analysis of polymorphisms].
21152100 2010 Association between acquired uniparental disomy and homozygous mutations and HER2/ER/PR status in breast cancer.
21148628 2011 Progesterone receptor gene variants and risk of endometrial cancer.
21145845 2011 High viral load and deregulation of the progesterone receptor signaling pathway: association with hepatitis E-related poor pregnancy outcome.
21141441 2010 Maternal and fetal PROGINS progesterone receptor polymorphism reduces the risk for transient tachypnea of the newborn.
21119048 2011 CDB-4124, a progesterone receptor modulator, inhibits mammary carcinogenesis by suppressing cell proliferation and inducing apoptosis.
21095220 2011 16?-hydroxyprogesterone: origin, biosynthesis and receptor interaction.
21093858 2011 Hormonal profile, the PROGINS polymorphism, and erectile dysfunction complaints: data from a population-based survey.
21086036 2011 Association of progesterone receptor polymorphism with idiopathic recurrent pregnancy loss in Taiwanese Han population.
21085752 2010 [Progesterone receptor gene polymorphism and recurrent spontaneous abortion].
21062926 2011 Combined analysis of estrogen receptor beta-1 and progesterone receptor expression identifies lung cancer patients with poor outcome.
21029696 2010 [Prognostic value of estrogen receptor, progesterone receptor and human epidermal growth factor receptor-2 in node positive breast cancer patients treated by mastectomy].
20962507 2011 Placental IGF-I, estrogen receptor, and progesterone receptor expression, and maternal anthropometry in growth-restricted pregnancies in the Swedish population.
20960162 2010 Identification of novel transcript variants of estrogen receptor ?, ? and progesterone receptor gene in human endometrium.
20959426 2010 Sex hormone receptor gene polymorphisms and migraine: a systematic review and meta-analysis.
20956022 2011 Polymorphisms in VEGF, progesterone receptor and IL-1 receptor genes in women with recurrent spontaneous abortion.
20946440 2011 Conventional progesterone receptors (PR) B and PRA are expressed in human spermatozoa and may be involved in the pathophysiology of varicocoele: a role for progesterone in metabolism.
20920367 2010 Favorable response to doxorubicin combination chemotherapy does not yield good clinical outcome in patients with metastatic breast cancer with triple-negative phenotype.
20890067 2010 Prognostic effect of hormone receptor status in early HER2 positive breast cancer patients.
20876300 2010 Progesterone receptor induces ErbB-2 nuclear translocation to promote breast cancer growth via a novel transcriptional effect: ErbB-2 function as a coactivator of Stat3.
20873988 2010 The oncotype DX recurrence score is correlated with a composite index including routinely reported pathobiologic features.
20872186 2011 ER, PgR, HER-2, Ki-67, topoisomerase II?, and nm23-H1 proteins expression as predictors of pathological complete response to neoadjuvant chemotherapy for locally advanced breast cancer.
20861224 2010 The progesterone receptor hinge region regulates the kinetics of transcriptional responses through acetylation, phosphorylation, and nuclear retention.
20844986 2011 Evaluation of ER, PgR, HER-2, Ki-67, cyclin D1, and nm23-H1 as predictors of pathological complete response to neoadjuvant chemotherapy for locally advanced breast cancer.
20829392 2010 Isoform-specific degradation of PR-B by E6-AP is critical for normal mammary gland development.
20814185 2010 Associations of progesterone receptor polymorphisms with age at menarche and menstrual cycle length.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20719308 2011 Progesterone receptor gene polymorphisms and risk of endometriosis: results from an international collaborative effort.
20716560 2010 Genetic variation within the hypothalamus-pituitary-ovarian axis in women with recurrent miscarriage.
20713855 2010 Qualitative assessment of the progesterone receptor and HER2 improves the Nottingham Prognostic Index up to 5 years after breast cancer diagnosis.
20690804 2010 A lower Allred score for progesterone receptor is strongly associated with a higher recurrence score of 21-gene assay in breast cancer.
20661446 2010 Differential impact of tetratricopeptide repeat proteins on the steroid hormone receptors.
20646629 2010 [BRCA1 selectively regulates the expression of progesterone receptor A in sporadic invasive ductal breast carcinoma].
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20592363 2010 Effects of phytoestrogen extracts isolated from flax on estradiol production and ER/PR expression in MCF7 breast cancer cells.
20586553 2011 Polymorphisms in ESR1, ESR2 and HSD17B1 genes are associated with fertility status in endometriosis.
20557310 2010 Comparison of core needle biopsy (CNB) and surgical specimens for accurate preoperative evaluation of ER, PgR and HER2 status of breast cancer patients.
20550710 2010 The ERalpha coactivator, HER4/4ICD, regulates progesterone receptor expression in normal and malignant breast epithelium.
20547493 2010 Genetic variation in the progesterone receptor gene and risk of endometrial cancer: a haplotype-based approach.
20484415 2010 Peroxisome proliferator-activated receptor gamma activation inhibits progesterone-stimulated human MUC1 expression.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20436503 2010 Issues and updates: evaluating estrogen receptor-alpha, progesterone receptor, and HER2 in breast cancer.
20404095 2010 Cyclin D1 enhances the response to estrogen and progesterone by regulating progesterone receptor expression.
20400074 2010 Prokineticin 1, homeobox A10, and progesterone receptor messenger ribonucleic acid expression in primary cultures of endometrial stromal cells isolated from endometrium of healthy women and from eutopic endometrium of women with endometriosis.
20392877 2010 Cooperative activation of cyclin D1 and progesterone receptor gene expression by the SRC-3 coactivator and SMRT corepressor.
20381444 2010 Polymorphisms in genes of the steroid hormone biosynthesis and metabolism pathways and endometrial cancer risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20374701 2009 Progesterone receptor action in leiomyoma and endometrial cancer.
20337826 2010 Oestrogen and progesterone receptor expression in melasma: an immunohistochemical analysis.
20335148 2010 [The correlation between the expression of PRL-R and ER/PR in breast cancer].
20308837 2010 Progesterone receptor genotype, family history, and spontaneous preterm birth.
20308044 2011 Familial and sporadic breast cancers: differences in clinical, histopathological, and immunohistochemical features.
20305341 2010 Evaluation of estrogen receptor alpha, estrogen receptor beta, progesterone receptor, and cKIT expression in desmoids tumors and their role in determining treatment options.
20299092 2010 CpG islands aberrant hypermethylation of sex hormone receptor superfamily might be involved in the development of leukemic neoplasms.
20228224 2010 Subcellular localization of activated AKT in estrogen receptor- and progesterone receptor-expressing breast cancers: potential clinical implications.
20167054 2010 The relationship of cerb B 2 expression with estrogen receptor and progesterone receptor and prognostic parameters in endometrial carcinomas.
20148360 2010 Genetic variation in sex-steroid receptors and synthesizing enzymes and colorectal cancer risk in women.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20124487 2010 Transcription factor KLF11 integrates progesterone receptor signaling and proliferation in uterine leiomyoma cells.
20123965 2010 Multimodal regulation of E2F1 gene expression by progestins.
20097334 2010 Endometrial stromal progesterone receptor-A/progesterone receptor-B ratio: no difference between women with and without endometriosis.
20096719 2010 Comparison between steroid binding to membrane progesterone receptor alpha (mPRalpha) and to nuclear progesterone receptor: correlation with physicochemical properties assessed by comparative molecular field analysis and identification of mPRalpha-specific agonists.
20090851 2010 Role of progesterone receptor polymorphisms in the recurrent spontaneous abortions: Indian case.
20087433 2009 Control of oocyte release by progesterone receptor-regulated gene expression.
20087430 2009 Progesterone action in human tissues: regulation by progesterone receptor (PR) isoform expression, nuclear positioning and coregulator expression.
20082875 2009 Expression of prostate apoptosis response (Par-4) is associated with progesterone receptor in breast cancer.
20082859 2010 Association of a progesterone receptor gene +331 G/A polymorphism with breast cancer risk: a meta-analysis.
20076999 2010 No association between a progesterone receptor gene promoter polymorphism (+331G>A) and breast cancer risk in Caucasian women: evidence from a literature-based meta-analysis.
20063045 2009 Interstitial Cajal-like cells of human Fallopian tube express estrogen and progesterone receptors.
20026682 2010 Silencing of the JNK pathway maintains progesterone receptor activity in decidualizing human endometrial stromal cells exposed to oxidative stress signals.
20019164 2010 Progesterone receptor A mediates VIP inhibition of contraction.
20000807 2010 Na(+) and K(+) allosterically regulate cooperative DNA binding by the human progesterone receptor.
19996313 2010 Celastrol inhibits Hsp90 chaperoning of steroid receptors by inducing fibrillization of the Co-chaperone p23.
19961842 2010 Clinical significance of Stratifin, ERalpha and PR promoter methylation in tumor and serum DNA in Indian breast cancer patients.
19952937 2010 MIB-1 (Ki-67), estrogen receptor, progesterone receptor, and p53 expression in atypical cells in uterine symplastic leiomyomas.
19952285 2010 Long-range transcriptional control of progesterone receptor gene expression.
19940364 2009 Prognostic relevance of promoter hypermethylation of multiple genes in breast cancer patients.
19940123 2010 Nuclear factor 1 synergizes with progesterone receptor on the mouse mammary tumor virus promoter wrapped around a histone H3/H4 tetramer by facilitating access to the central hormone-responsive elements.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19887485 2009 Microarray-based determination of estrogen receptor, progesterone receptor, and HER2 receptor status in breast cancer.
19852793 2009 Prostaglandin treatment is associated with a withdrawal of progesterone and androgen at the receptor level in the uterine cervix.
19846565 2009 Genetic variation in the progesterone receptor and metabolism pathways and hormone therapy in relation to breast cancer risk.
19838027 2009 [Clinicopathological features of young patients with triple negative breast cancer].
19835506 2009 A comparison of oestrogen receptor and progesterone receptor expression in endometrial polyps and endometrium of premenopausal women.
19820388 2009 Comparative evaluation of estrogen and progesterone receptor expression with connexins 26 and 43 in endometrial cancer.
19809499 2009 Catechol-o-methyltransferase expression and 2-methoxyestradiol affect microtubule dynamics and modify steroid receptor signaling in leiomyoma cells.
19782484 2009 Does the progesterone receptor genetic polymorphism +331G/A hPR influence the risk of venous thromboembolism among postmenopausal women using hormone therapy? The ESTHER Study.
19762712 2009 Is expression or activation of Src kinase associated with cancer-specific survival in ER-, PR- and HER2-negative breast cancer patients?
19739075 2010 Polymorphisms in genes of the steroid receptor superfamily modify postmenopausal breast cancer risk associated with menopausal hormone therapy.
19720911 2009 Prediction of local recurrence, distant metastases, and death after breast-conserving therapy in early-stage invasive breast cancer using a five-biomarker panel.
19715581 2009 Distribution and hormonal regulation of membrane progesterone receptors beta and gamma in ciliated epithelial cells of mouse and human fallopian tubes.
19706513 2009 Protein kinases mediate ligand-independent derepression of sumoylated progesterone receptors in breast cancer cells.
19701771 2009 The progesterone receptor regulates the expression of TRPV4 channel.
19696694 2009 Fetal sex determines the impact of maternal PROGINS progesterone receptor polymorphism on maternal physiology during pregnancy.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19676041 2010 Loss of STARD10 expression identifies a group of poor prognosis breast cancers independent of HER2/Neu and triple negative status.
19673915 2010 Role of the oestrogen receptor (ESR1 PvuII and ESR1 325 C->G) and progesterone receptor (PROGINS) polymorphisms in genetic susceptibility to migraine in a North Indian population.
19657752 2010 Alterations of ER, PR, HER-2/neu, and P53 protein expression in ductal breast carcinomas and clinical implications.
19636371 2009 Genetic polymorphisms in the EGFR (R521K) and estrogen receptor (T594T) genes, EGFR and ErbB-2 protein expression, and breast cancer risk in Tunisia.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19604497 2009 Association study of gender identity disorder and sex hormone-related genes.
19574486 2009 Breast cancer subtypes based on ER/PR and Her2 expression: comparison of clinicopathologic features and survival.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19555469 2009 A prospective study of androgen levels, hormone-related genes and risk of rheumatoid arthritis.
19551860 2009 Common germline polymorphisms in COMT, CYP19A1, ESR1, PGR, SULT1E1 and STS and survival after a diagnosis of breast cancer.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19499404 2009 Dual actions of progesterone on uterine leiomyoma correlate with the ratio of progesterone receptor A:B.
19497994 2009 Disrupted cell cycle control in cultured endometrial cells from patients with endometriosis harboring the progesterone receptor polymorphism PROGINS.
19476621 2009 Progesterone receptor does not improve the performance and test effectiveness of the conventional 3-marker panel, consisting of estrogen receptor, vimentin and carcinoembryonic antigen in distinguishing between primary endocervical and endometrial adenocarcinomas in a tissue microarray extension study.
19462450 2009 +331G/A variant in the progesterone receptor gene, postmenopausal hormone use and risk of breast cancer.
19458022 2009 Androgen, progesterone, and FSH receptor polymorphisms in ovarian cancer risk and outcome.
19436038 2009 Ki67 index, HER2 status, and prognosis of patients with luminal B breast cancer.
19423654 2009 p54nrb is a transcriptional corepressor of the progesterone receptor that modulates transcription of the labor-associated gene, connexin 43 (Gja1).
19423537 2009 Five polymorphisms and breast cancer risk: results from the Breast Cancer Association Consortium.
19419938 2009 Differentiated expression of estrogen receptors (ER) and progesterone receptors (PgR) in ductal breast cancers.
19415745 2009 Genetic polymorphisms of estrogen metabolizing enzyme and breast cancer risk in Thai women.
19389812 2009 Mechanism of BRCA1-mediated inhibition of progesterone receptor transcriptional activity.
19383545 2009 Progestins induce catalase activities in breast cancer cells through PRB isoform: correlation with cell growth inhibition.
19382201 2009 Association of the progesterone receptor gene with endometrial cancer risk in a Chinese population.
19372234 2009 ALU repeats in promoters are position-dependent co-response elements (coRE) that enhance or repress transcription by dimeric and monomeric progesterone receptors.
19367380 2009 Progesterone receptors A and B and estrogen receptor alpha expression in normal breast tissue and fibroadenomas.
19339282 2009 Interplay between polypyrimidine tract binding protein-associated splicing factor and human myometrial progesterone receptors.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19330259 2009 Polymorphism in CYP17, GSTM1 and the progesterone receptor genes and its relationship with mammographic density.
19309393 2009 The expression of ERalpha, ERbeta and PR in lobular carcinoma in situ of the breast determined using laser microdissection and real-time PCR.
19299443 2009 Mutational analysis of progesterone receptor functional domains in stable cell lines delineates sets of genes regulated by different mechanisms.
19296948 2009 Immunoreactivity of progesterone receptor isoform B, nuclear factor kappaB, and IkappaBalpha in adenomyosis.
19284643 2009 The cytoplasmic 60 kDa progesterone receptor isoform predominates in the human amniochorion and placenta at term.
19267271 2009 Progesterone receptor polymorphism is associated with pelvic organ prolapse risk.
19258476 2009 CpG island tumor suppressor promoter methylation in non-BRCA-associated early mammary carcinogenesis.
19220894 2009 Progesterone receptor A and c-Met mediates spheroids-endometrium attachment.
19217090 2010 Estrogen and progesterone receptors in smooth muscle component of deep infiltrating endometriosis.
19211567 2009 Mechanisms underlying the control of progesterone receptor transcriptional activity by SUMOylation.
19208313 2009 Morphological profile and association of HER-2/neu with prognostic markers in breast carcinoma in Northern Pakistan.
19208263 2009 Oncoprotein HCCR-1 expression in breast cancer is well correlated with known breast cancer prognostic factors including the HER2 overexpression, p53 mutation, and ER/PR status.
19205877 2010 Progesterone receptor is a significant factor associated with clinical outcomes and effect of adjuvant tamoxifen therapy in breast cancer patients.
19205874 2009 Progesterone and estrogen receptors in pregnant and premenopausal non-pregnant normal human breast.
19196877 2009 Nuclear progesterone receptor expression in the human fetal membranes and decidua at term before and after labor.
19175383 2009 Lack of association of hormone receptor polymorphisms with migraine.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19154258 2009 Protein expression of nuclear receptors in human and murine tissues.
19152063 2009 Polymorphisms in estrogen metabolism and estrogen pathway genes and the risk of miscarriage.
19147702 2009 Progesterone receptor B recruits a repressor complex to a half-PRE site of the estrogen receptor alpha gene promoter.
19147544 2009 Direct progesterone receptor and indirect androgen receptor interactions with the kallikrein-related peptidase 4 gene promoter in breast and prostate cancer.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19106225 2009 Progesterone Inhibits basal and gonadotropin-releasing hormone induction of luteinizing hormone beta-subunit gene expression.
19095059 2009 Regulation of progesterone receptor isoforms content in human astrocytoma cell lines.
19094228 2008 The influence of genetic variation in 30 selected genes on the clinical characteristics of early onset breast cancer.
19093516 2007 Progesterone receptor positive colorectal tumors have lower thymidine phosphorylase expression: an immunohistochemical study.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19061285 2008 Immunohistochemical expression of estrogen and progesterone receptors in primary pulmonary neuroendocrine tumors.
19056530 2008 The presence and role of progesterone receptor in the ovaries of postmenopausal women who have not applied hormone replacement therapy.
19031960 Association between genetic polymorphisms and ovarian cancer risk.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18980792 2009 Gonadotropin-releasing hormone (GnRH) and its receptor in human meningiomas.
18850387 2008 Effects of pre- and postmenopausal use of exogenous hormones on receptor content in normal human breast tissue: a randomized study.
18835831 Comparing expression of progesterone and estrogen receptors in testicular tissue from men with obstructive and nonobstructive azoospermia.
18819936 2008 Progesterone receptor-B regulation of insulin-like growth factor-stimulated cell migration in breast cancer cells via insulin receptor substrate-2.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18801410 2008 Detection of potential (anti)progestagenic endocrine disruptors using a recombinant human progesterone receptor binding and transactivation assay.
18798271 2009 Estrogen alpha and progesterone receptor expression in the normal mammary epithelium in relation to breast cancer risk.
18776045 2008 Overexpression of progesterone receptor B increases sensitivity of human colon muscle cells to progesterone.
18722616 2008 Progesterone receptor gene polymorphisms are not associated with preterm birth in a Hispanic population.
18691687 2008 Single nucleotide polymorphisms in the progesterone receptor gene and association with uterine leiomyoma tumor characteristics and disease risk.
18686353 2008 ER, PR and Ki-67 expression status in granulomatous and chronic non-specific endometritis.
18683043 2009 Low activation of Insulin-like Growth Factor 1-Receptor (IGF1R) is associated with local recurrence in early breast carcinoma.
18681990 2008 Altered expression of progesterone receptors in testis of infertile men.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18668363 2009 Gene expression of estrogen receptor, progesterone receptor and microtubule-associated protein Tau in high-risk early breast cancer: a quest for molecular predictors of treatment benefit in the context of a Hellenic Cooperative Oncology Group trial.
18665217 2008 Extra-nuclear signaling of progesterone receptor to breast cancer cell movement and invasion through the actin cytoskeleton.
18645713 2008 Associations between serum testosterone levels, cell proliferation and progesterone receptor content in normal and malignant breast tissue in postmenopausal women.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18631401 2008 Genes responsive to both oxidant stress and loss of estrogen receptor function identify a poor prognosis group of estrogen receptor positive primary breast cancers.
18629635 2009 Short-term outcome of primary operated early breast cancer by hormone and HER-2 receptors.
18628428 2008 Polymorphisms in genes involved in sex hormone metabolism, estrogen plus progestin hormone therapy use, and risk of postmenopausal breast cancer.
18617611 2008 Systematic expression analysis and antibody screening do not support the existence of naturally occurring progesterone receptor (PR)-C, PR-M, or other truncated PR isoforms.
18557990 2008 Alternative splicing and the progesterone receptor in breast cancer.
18511503 2008 The androgen and progesterone receptors regulate distinct gene networks and cellular functions in decidualizing endometrium.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18508999 2008 Expression of progesterone and estradiol receptors in normal adrenal cortex, adrenocortical tumors, and primary pigmented nodular adrenocortical disease.
18483761 2008 Hormone receptor-related gene polymorphisms and prostate cancer risk in North Indian population.
18483177 2008 Progesterone receptor inhibits aromatase and inflammatory response pathways in breast cancer cells via ligand-dependent and ligand-independent mechanisms.
18481002 2008 Selective expression of progesterone receptor in malignant melanoma was inversely correlated with PCNA.
18421469 2008 Human umbilical vascular endothelial cells express estrogen receptor beta (ERbeta) and progesterone receptor A (PR-A), but not ERalpha and PR-B.
18394649 2009 Estrogen receptor alpha, estrogen receptor beta, and progesterone receptor as possible prognostic factor in radically resected gallbladder carcinoma.
18392676 2008 Association of progesterone receptor polymorphisms with recurrent implantation failure after in vitro fertilization and embryo transfer.
18391223 2008 Rare steroid receptor-negative basal-like tumorigenic cells in luminal subtype human breast cancer xenografts.
18386458 2008 Immunohistochemical bcl-2 expression, p53 overexpression, PR and ER status in endometrial carcinoma and survival outcomes.
18384825 2008 Progesterone receptor (PROGINS) polymorphism and the risk of ovarian cancer.
18378698 2008 Progesterone induction of the 11beta-hydroxysteroid dehydrogenase type 2 promoter in breast cancer cells involves coordinated recruitment of STAT5A and progesterone receptor to a distal enhancer and polymerase tracking.
18375150 2008 The human progesterone receptor shows evidence of adaptive evolution associated with its ability to act as a transcription factor.
18321550 2008 The role and mechanism of progesterone receptor activation of extra-nuclear signaling pathways in regulating gene transcription and cell cycle progression.
18316616 2008 Selective inhibition of histone deacetylase 2 silences progesterone receptor-mediated signaling.
18313072 2008 Thermodynamic dissection of progesterone receptor interactions at the mouse mammary tumor virus promoter: monomer binding and strong cooperativity dominate the assembly reaction.
18281038 2008 Progesterone receptor +331G/A polymorphism in endometriosis and deep-infiltrating endometriosis.
18276950 2008 Single nucleotide polymorphisms in the human progesterone receptor gene and spontaneous preterm birth.
18249378 2008 The knockdown of progesterone receptor isoform B (PR-B) promotes proliferation in immortalized endometrial stromal cells.
18219286 2008 Progesterone receptor variation and risk of ovarian cancer is limited to the invasive endometrioid subtype: results from the Ovarian Cancer Association Consortium pooled analysis.
18215457 2008 Differential modulation of glucocorticoid and progesterone receptor transactivation.
18202149 2008 Progesterone receptor rapid signaling mediates serine 345 phosphorylation and tethering to specificity protein 1 transcription factors.
18197009 2008 Promotion of BRCA1-associated triple-negative breast cancer by ovarian hormones.
18189290 2008 The role of human epidermal growth factor receptor 2 in the survival of women with estrogen and progesterone receptor-negative, invasive breast cancer: the California Cancer Registry, 1999-2004.
18184269 2008 CD1a down-regulation in primary invasive ductal breast carcinoma may predict regional lymph node invasion and patient outcome.
18096667 2008 The regulation and function of the forkhead transcription factor, Forkhead box O1, is dependent on the progesterone receptor in endometrial carcinoma.
18048499 2008 Inflammatory status influences aromatase and steroid receptor expression in endometriosis.
18042733 2008 Progesterone receptor (PR) isoforms PRA and PRB differentially regulate expression of the breast cancer resistance protein in human placental choriocarcinoma BeWo cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17992477 2006 Estrogen and progesterone receptors expression in gastrointestinal stromal tumors and intramural gastrointestinal leiomyomas.
17965625 Promoter hypermethylation of progesterone receptor isoform B (PR-B) in endometriosis.
17958742 2007 Upregulation of protein S by progestins.
17951080 2008 Estrogen and progesterone receptors in carpal tunnel syndrome.
17950525 2007 Progesterone receptor expression is a marker for early stage breast cancer: implications for progesterone receptor as a therapeutic tool and target.
17919323 2007 The progesterone receptor PROGINS polymorphism is not related to oxidative stress factors in women with polycystic ovary syndrome.
17914494 2007 Angiogenesis and progesterone receptor status in primary breast cancer patients: an analysis of 158 needle core biopsies.
17896177 2008 Progesterone receptor B (PRB) promoter hypermethylation in sporadic breast cancer: progesterone receptor B hypermethylation in breast cancer.
17885486 2007 Estrogen receptor alpha and progesterone receptor expression in ovarian adult granulosa cell tumors and Sertoli-Leydig cell tumors.
17847935 2007 Estrogen and progesterone receptor status in primary breast cancer--a study of 11,273 patients from the year 1990 to 2002.
17845055 2007 Coactivator assembly at the promoter: efficient recruitment of SRC2 is coupled to cooperative DNA binding by the progesterone receptor.
17805208 2007 Evaluation of fetal and maternal genetic variation in the progesterone receptor gene for contributions to preterm birth.
17785366 2007 Progesterone receptor regulates Bcl-2 gene expression through direct binding to its promoter region in uterine leiomyoma cells.
17727850 2008 Prolonged stimulation with tumor necrosis factor-alpha induced partial methylation at PR-B promoter in immortalized epithelial-like endometriotic cells.
17717077 2007 Phosphorylation-dependent antagonism of sumoylation derepresses progesterone receptor action in breast cancer cells.
17646097 2007 Transcriptional analysis of steroid hormone receptors in smooth muscle uterine leiomyoma tumors of postmenopausal patients.
17609999 2007 Association of progesterone receptor with migraine-associated vertigo.
17609436 2007 Transcriptional cross talk between the forkhead transcription factor forkhead box O1A and the progesterone receptor coordinates cell cycle regulation and differentiation in human endometrial stromal cells.
17599361 2007 Promoter hypermethylation of TMS1, BRCA1, ERalpha and PRB in serum and tumor DNA of invasive ductal breast carcinoma patients.
17592773 2008 Progesterone receptor polymorphisms and risk of breast cancer: results from two Australian breast cancer studies.
17522428 2007 Association of progesterone receptor gene polymorphism (PROGINS) with endometriosis, uterine fibroids and breast cancer.
17512111 2007 Progesterone, glucocorticoid, but not estrogen receptor mRNA is altered in breast cancer stroma.
17484509 2007 Genetic polymorphisms of cytochrome P450cl7alpha (CYP17) and progesterone receptor genes (PROGINS) in the assessment of endometriosis risk.
17413977 2007 Expression of estrogen and progesterone receptors in smooth muscle metaplasia of rectovaginal endometriosis.
17347654 2007 CUE domain containing 2 regulates degradation of progesterone receptor by ubiquitin-proteasome.
17316413 2007 p27KIP-1, cyclin A and cyclin D1 protein expression in ductal carcinoma in situ of the breast: p27KIP-1 correlates with hormone receptor status but not with local recurrence.
17293450 2007 The PROGINS polymorphism of the human progesterone receptor diminishes the response to progesterone.
17291258 Progesterone receptor (PROGINS) polymorphism and the risk of endometrial cancer development.
17277083 2007 Thermodynamic analysis of progesterone receptor-promoter interactions reveals a molecular model for isoform-specific function.
17259978 2007 Activating gene expression in mammalian cells with promoter-targeted duplex RNAs.
17224149 2007 The progesterone receptor gene polymorphism, PROGINS, may be a factor related to the development of uterine fibroids.
17173941 2007 Linkage of progestin and epidermal growth factor signaling: phosphorylation of progesterone receptors mediates transcriptional hypersensitivity and increased ligand-independent breast cancer cell growth.
17021053 2007 Focal subnuclear distribution of progesterone receptor is ligand dependent and associated with transcriptional activity.
17020914 2006 PIAS3 induction of PRB sumoylation represses PRB transactivation by destabilizing its retention in the nucleus.
17018785 2006 Commonly studied single-nucleotide polymorphisms and breast cancer: results from the Breast Cancer Association Consortium.
17006756 2007 Coexistence of the loss of heterozygosity at the PTEN locus and HER2 overexpression enhances the Akt activity thus leading to a negative progesterone receptor expression in breast carcinoma.
16999816 2006 Progesterone receptor isoforms as a prognostic marker in human endometrial carcinoma.
16985250 2006 Estrogen sulfation genes, hormone replacement therapy, and endometrial cancer risk.
16973758 2007 Progesterone receptor repression of prolactin/signal transducer and activator of transcription 5-mediated transcription of the beta-casein gene in mammary epithelial cells.
16920727 2007 Progesterone receptor polymorphism +331G/A is associated with a decreased risk of deep infiltrating endometriosis.
16901007 Glassy cell carcinoma of the cervix: cytologic features and expression of estrogen receptor, progesterone receptor and Her2/neu protein.
16799708 2006 Prevalence of hormone receptors and HER2/neu in breast cancer cases in Jordan.
16772530 2006 Progesterone receptor plays a major antiinflammatory role in human myometrial cells by antagonism of nuclear factor-kappaB activation of cyclooxygenase 2 expression.
16762974 2006 Progesterone receptors (PR)-B and -A regulate transcription by different mechanisms: AF-3 exerts regulatory control over coactivator binding to PR-B.
16759928 2006 Glycodelin is present in pinopodes of receptive-phase human endometrium and is associated with down-regulation of progesterone receptor B.
16647340 2006 Transgenic introduction of androgen receptor into estrogen-receptor-, progesterone-receptor-, and androgen-receptor-negative breast cancer cells renders them responsive to hormonal manipulation.
16646051 2006 Body weight and postmenopausal breast cancer risk defined by estrogen and progesterone receptor status among Swedish women: A prospective cohort study.
16614108 2006 Association of the progesterone receptor gene with breast cancer risk: a single-nucleotide polymorphism tagging approach.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16537702 2006 Influence of estrogen receptor alpha and progesterone receptor polymorphisms on the effects of hormone therapy on mammographic density.
16524927 2006 In vitro culture significantly alters gene expression profiles and reduces differences between myometrial and fibroid smooth muscle cells.
16481409 2006 Examining the spatio-temporal expression of mRNA encoding the membrane-bound progesterone receptor-alpha isoform in human cervix and myometrium during pregnancy and labour.
16478993 2006 GCUNC-45 is a novel regulator for the progesterone receptor/hsp90 chaperoning pathway.
16477637 2006 Estrogen and progesterone receptor gene polymorphisms and sporadic breast cancer risk: a Spanish case-control study.
16439457 2006 Identification of a signaling pathway involving progesterone receptor, calcitonin, and tissue tranglutaminase in Ishikawa endometrial cells.
16384861 2006 Progesterone receptor transactivation of the secretory leukocyte protease inhibitor gene in Ishikawa endometrial epithelial cells involves recruitment of Krüppel-like factor 9/basic transcription element binding protein-1.
16360811 2006 Two functionally relevant polymorphisms in the human progesterone receptor gene (+331 G/A and progins) and the predisposition for breast and/or ovarian cancer.
16339776 2005 Variant progesterone receptor mRNAs are co-expressed with the wild-type progesterone receptor mRNA in human endometrium during all phases of the menstrual cycle.
16339279 2006 Up-regulation of the progesterone receptor (PR)-C isoform in laboring myometrium by activation of nuclear factor-kappaB may contribute to the onset of labor through inhibition of PR function.
16331541 2005 Ratio of mRNA expression of progesterone receptor isoforms AB is to B in human oviduct mucosal cells during the ovulatory cycle.
16323958 Effect of initial subcellular localization of progesterone receptor on import kinetics and transcriptional activity.
16244490 2006 Association of endometriosis risk and genetic polymorphisms involving sex steroid biosynthesis and their receptors: a meta-analysis.
16168103 2005 Immunohistochemical evaluation of human epidermal growth factor receptor 2 and estrogen and progesterone receptors in breast carcinoma in Jordan.
16126772 2005 Association between polymorphisms in the progesterone receptor gene and endometriosis.
15996107 2005 Self-association energetics of an intact, full-length nuclear receptor: the B-isoform of human progesterone receptor dimerizes in the micromolar range.
15937332 2005 Molecular and pharmacological properties of a potent and selective novel nonsteroidal progesterone receptor agonist tanaproget.
15866121 2005 Differences in invasive capacity of endometrial cancer cell lines expressing different progesterone receptor isotypes: possible involvement of cadherins.
15863956 2005 Progesterone receptor subtypes in vascular smooth muscle cells of human aorta.
15807882 2005 PROGINS Alu sequence insertion is associated with hyperprolactinaemia but not leiomyoma susceptibility.
15798179 2005 Human progesterone receptor displays cell cycle-dependent changes in transcriptional activity.
15797250 2005 Conditional regulation of the human CYP4X1 and CYP4Z1 genes.
15743833 2005 Ligand-specific dynamics of the progesterone receptor in living cells and during chromatin remodeling in vitro.
15728178 2005 A novel antiestrogenic mechanism in progesterone receptor-transfected breast cancer cells.
15718480 2005 Genetic variation in the progesterone receptor gene and ovarian cancer risk.
15698546 2004 Allelic genes involved in artery compliance and susceptibility to sporadic abdominal aortic aneurysm.
15694360 2005 Potentiation of estrogen receptor transcriptional activity by breast cancer amplified sequence 2.
15694343 2005 Steroid hormone receptor coactivation and alternative RNA splicing by U2AF65-related proteins CAPERalpha and CAPERbeta.
15654614 2005 Investigation of hormone receptor genes in migraine.
15632380 2005 Clarifying the PROGINS allele association in ovarian and breast cancer risk: a haplotype-based analysis.
15613410 2005 Endometrial endothelial cell steroid receptor expression and steroid effects on gene expression.
15607534 2005 Frequent loss of estrogen and progesterone receptors in human prostatic tumors determined by quantitative real-time PCR.
15601848 2005 Cyclin-dependent kinase activity is required for progesterone receptor function: novel role for cyclin A/Cdk2 as a progesterone receptor coactivator.
15598772 2004 Progesterone receptor promoter +331A polymorphism is associated with a reduced risk of endometrioid and clear cell ovarian cancers.
15579801 2004 A germline variation in the progesterone receptor gene increases transcriptional activity and may modify ovarian cancer risk.
15572662 2004 Phosphorylation of progesterone receptor serine 400 mediates ligand-independent transcriptional activity in response to activation of cyclin-dependent protein kinase 2.
15572421 2005 Progesterone receptor modulator CDB-2914 down-regulates proliferative cell nuclear antigen and Bcl-2 protein expression and up-regulates caspase-3 and poly(adenosine 5'-diphosphate-ribose) polymerase expression in cultured human uterine leiomyoma cells.
15563544 2005 Progesterone-independent effects of human progesterone receptors (PRs) in estrogen receptor-positive breast cancer: PR isoform-specific gene regulation and tumor biology.
15562029 2005 Differential role of progesterone receptor isoforms in the transcriptional regulation of human gonadotropin-releasing hormone I (GnRH I) receptor, GnRH I, and GnRH II.
15555905 2004 Significance of progesterone receptor-A and -B expressions in endometrial adenocarcinoma.
15535845 2004 The progesterone receptor Val660-->Leu polymorphism and breast cancer risk.
15509639 2005 Coexistence of intracellular and membrane-bound progesterone receptors in human testis.
15381922 2005 Estrogen receptor 2 and progesterone receptor gene polymorphisms and lipid levels in women with different hormonal status.
15330195 Genetic polymorphisms of hormone-related genes and prostate cancer risk in the Japanese population.
15282324 2004 Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.
15272917 2004 Polymorphisms in oestrogen and progesterone receptor genes: possible influence on prolactin levels in women.
15272913 2004 Genetics of endometriosis: a role for the progesterone receptor gene polymorphism PROGINS?
15219637 2004 Association between a functional polymorphism in the progesterone receptor gene and panic disorder in women.
15184270 2004 No association between the progesterone receptor gene +331G/A polymorphism and breast cancer.
15171716 2004 Intramolecular interactions between the AF3 domain and the C-terminus of the human progesterone receptor are mediated through two LXXLL motifs.
15102680 2004 Breast cancer patients with progesterone receptor PR-A-rich tumors have poorer disease-free survival rates.
15084345 2004 Molecular mechanism of estrogen receptor (ER)alpha-specific, estradiol-dependent expression of the progesterone receptor (PR) B-isoform.
15084343 2004 Differential regulation of the human progesterone receptor gene through an estrogen response element half site and Sp1 sites.
15036714 2004 Association of progesterone receptor polymorphism with recurrent abortions.
15001645 2004 Subnuclear distribution of progesterone receptors A and B in normal and malignant endometrium.
14978266 2004 Molecular chaperones function as steroid receptor nuclear mobility factors.
14769635 2004 Ovarian cancer and polymorphisms in the androgen and progesterone receptor genes: a HuGE review.
14764828 2004 Prostaglandins differentially modulate progesterone receptor-A and -B expression in human myometrial cells: evidence for prostaglandin-induced functional progesterone withdrawal.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684847 2004 Fos and Jun inhibit estrogen-induced transcription of the human progesterone receptor gene through an activator protein-1 site.
14667967 2003 Progesterone-dependent regulation of female reproductive activity by two distinct progesterone receptor isoforms.
14667966 2003 Progesterone receptor transcription and non-transcription signaling mechanisms.
14634838 2003 Allele frequencies of single nucleotide polymorphisms (SNPs) in 40 candidate genes for gene-environment studies on cancer: data from population-based Japanese random samples.
14617569 2004 Glucocorticoid and mineralocorticoid cross-talk with progesterone receptor to induce focal adhesion and growth inhibition in breast cancer cells.
14586360 2003 Human progesterone receptor polymorphisms and implantation failure during in vitro fertilization.
14557830 2004 Correlates of obesity in postmenopausal women with breast cancer: comparison of genetic, demographic, disease-related, life history and dietary factors.
14551264 2003 Novel activation step required for transcriptional competence of progesterone receptor on chromatin templates.
14519645 2003 Consequences of loss of progesterone receptor expression in development of invasive endometrial cancer.
14500352 2003 A functional polymorphism in the progesterone receptor gene is associated with an increase in breast cancer risk.
12943706 2003 Functional properties of the N-terminal region of progesterone receptors and their mechanistic relationship to structure.
12917342 2003 BAF60a mediates critical interactions between nuclear receptors and the BRG1 chromatin-remodeling complex for transactivation.
12899921 2003 The multiple promoter methylation profile of PR gene and ERalpha gene in tumor cell lines.
12861133 2003 Estrogen and progesterone receptor subtype expression in normal and malignant ovarian epithelial cell cultures.
12771131 2003 Repressors of androgen and progesterone receptor action.
12759236 2003 Progesterone induces cellular differentiation in MDA-MB-231 breast cancer cells transfected with progesterone receptor complementary DNA.
12748280 2003 Progesterone and glucocorticoid receptors recruit distinct coactivator complexes and promote distinct patterns of local chromatin modification.
12699057 Overall survival in advanced breast cancer: relevance of progesterone receptor expression and DNA ploidy in fine-needle aspirates of 392 patients.
12673676 2003 Novel alternatively spliced variant with a deletion of 52 BP in exon 6 of the progesterone receptor gene is observed frequently in breast cancer tissues.
12672823 2003 Selective interactions of Kruppel-like factor 9/basic transcription element-binding protein with progesterone receptor isoforms A and B determine transcriptional activity of progesterone-responsive genes in endometrial epithelial cells.
12650698 2002 Novel isoforms of the mRNA for human female sex steroid hormone receptors.
12644308 2003 Cloning and expression of a novel, truncated, progesterone receptor.
12612073 2003 Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.
12594000 2003 Ethnic variations in uterine leiomyoma biology are not caused by differences in myometrial estrogen receptor alpha levels.
12579263 Expression of a novel splicing variant deleting exons 4 and 6 of the progesterone receptor gene is a rare event in breast cancer.
12556966 2003 Accumulation of uPA-PAI-1 complexes inside the tumour cells is associated with axillary nodal invasion in progesterone-receptor-positive early breast cancer.
12554776 2003 Mitogen-activated protein kinase regulates nuclear association of human progesterone receptors.
12554765 2003 Insulin-like growth factor-I inhibits progesterone receptor expression in breast cancer cells via the phosphatidylinositol 3-kinase/Akt/mammalian target of rapamycin pathway: progesterone receptor as a potential indicator of growth factor activity in breast cancer.
12538866 2003 Structure of the large FK506-binding protein FKBP51, an Hsp90-binding protein and a component of steroid receptor complexes.
12529333 2003 Sumoylation of the progesterone receptor and of the steroid receptor coactivator SRC-1.
12517594 2003 Distinct functional differences of human progesterone receptors A and B on gene expression and growth regulation in two endometrial carcinoma cell lines.
12466272 2003 Regulation of nuclear receptor transcriptional activity by a novel DEAD box RNA helicase (DP97).
12446585 2002 Estrogen receptor alpha and activating protein-1 mediate estrogen responsiveness of the progesterone receptor gene in MCF-7 breast cancer cells.
12414909 2002 Progesterone production and actions in the human central nervous system and neurogenic tumors.
12402980 2002 Progesterone receptor mRNA variant containing novel exon insertions between exon 4 and exon 5 in human uterine endometrium.
12297552 2002 Progesterone receptor as an indicator of sperm function.
12218173 2002 A functional polymorphism in the promoter of the progesterone receptor gene associated with endometrial cancer risk.
12174912 Immunohistochemical analysis of 1,25-dihydroxyvitamin-D3-receptors, estrogen and progesterone receptors and Ki-67 in ovarian carcinoma.
12149147 2002 Differential expression of progesterone receptor isoforms A and B in the normal ovary, and in benign, borderline, and malignant ovarian tumors.
12114521 2002 The inhibitory function in human progesterone receptor N termini binds SUMO-1 protein to regulate autoinhibition and transrepression.
12113882 Estrogen receptor alpha and progesterone receptor A and B concentration and localization in the lower uterine segment in term parturition.
12101239 2002 Jun dimerization protein 2 functions as a progesterone receptor N-terminal domain coactivator.
12088866 2002 Progesterone receptor activates its promoter activity in human endometrial stromal cells.
12058073 2002 Novel ATPase of SNF2-like protein family interacts with androgen receptor and modulates androgen-dependent transcription.
12048256 2002 Coactivator/corepressor ratios modulate PR-mediated transcription by the selective receptor modulator RU486.
12039952 2002 Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
12038703 2002 Human progesterone receptor gene polymorphism PROGINS and risk for breast cancer in Austrian women.
12021276 2002 New human breast cancer cells to study progesterone receptor isoform ratio effects and ligand-independent gene regulation.
12011095 2002 EDD, the human hyperplastic discs protein, has a role in progesterone receptor coactivation and potential involvement in DNA damage response.
12009358 2002 Decreased progesterone receptor expression in the intermediate trophoblastic cells of spontaneous abortions.
11918216 2002 Estrogen receptor isoform-specific induction of progesterone receptors in human osteoblasts.
11821088 2002 PROGINS receptor gene polymorphism is associated with endometriosis.
11677150 The PROGINS progesterone receptor gene polymorphism and idiopathic recurrent miscarriage.
11668524 2001 Analysis of the human progesterone receptor gene polymorphism progins in Austrian ovarian carcinoma patients.
11668223 2001 Progesterone receptor variant increases ovarian cancer risk in BRCA1 and BRCA2 mutation carriers who were never exposed to oral contraceptives.
11545730 2001 Progesterone receptor contains a proline-rich motif that directly interacts with SH3 domains and activates c-Src family tyrosine kinases.
11326686 PROGINS polymorphism of progesterone receptor is increased in female offspring with maternal exposure to diethylstilbestrol.
11323389 2001 No significant association between progesterone receptor exon 4 Val660Leu G/T polymorphism and risk of ovarian cancer.
11117529 2000 ARIP3 (androgen receptor-interacting protein 3) and other PIAS (protein inhibitor of activated STAT) proteins differ in their ability to modulate steroid receptor-dependent transcriptional activation.
11117526 2000 Ligand-activated progesterone receptor isoform hPR-A is a stronger transactivator than hPR-B for the expression of IGFBP-1 (insulin-like growth factor binding protein-1) in human endometrial stromal cells.
11110801 2001 Identification of a phosphorylation site in the hinge region of the human progesterone receptor and additional amino-terminal phosphorylation sites.
10840043 2000 Structural evidence for ligand specificity in the binding domain of the human androgen receptor. Implications for pathogenic gene mutations.
10819762 2000 Detection of progesterone receptor transcript in human spermatozoa.
10757795 2000 The opposing transcriptional activities of the two isoforms of the human progesterone receptor are due to differential cofactor binding.
10750018 2000 Association of the Ku autoantigen/DNA-dependent protein kinase holoenzyme and poly(ADP-ribose) polymerase with the DNA binding domain of progesterone receptors.
10684807 2000 A putative stimulatory role of progesterone acting via progesterone receptors in the steroidogenic cells of the human corpus luteum.
10655479 2000 Phosphorylation of human progesterone receptors at serine-294 by mitogen-activated protein kinase signals their degradation by the 26S proteasome.
10628747 2000 Differential hormone-dependent phosphorylation of progesterone receptor A and B forms revealed by a phosphoserine site-specific monoclonal antibody.
10480874 1999 Selective binding of steroid hormone receptors to octamer transcription factors determines transcriptional synergism at the mouse mammary tumor virus promoter.
10338464 1999 Variant estrogen and progesterone receptor messages in human vascular smooth muscle.
9891052 1999 The Angelman syndrome-associated protein, E6-AP, is a coactivator for the nuclear hormone receptor superfamily.
9671457 1998 High-mobility group chromatin proteins 1 and 2 functionally interact with steroid hormone receptors to enhance their DNA binding in vitro and transcriptional activity in mammalian cells.
9620806 1998 Atomic structure of progesterone complexed with its receptor.
9598870 1998 Progesterone receptor variants found in breast cells repress transcription by wild-type receptors.
9305541 1997 Expression of progesterone receptor mRNA in the first trimester human placenta.
9171245 1997 Phosphorylation of human progesterone receptor by cyclin-dependent kinase 2 on three sites that are authentic basal phosphorylation sites in vivo.
9115274 1997 Differential interaction of nuclear receptors with the putative human transcriptional coactivator hTIF1.
8702648 1996 Stoichiometry and site-specific phosphorylation of human progesterone receptor in native target cells and in the baculovirus expression system.
8671234 1996 Progesterone receptor immunoreactivity at the maternofetal interface of first trimester pregnancy: a study of the trophoblast population.
8626413 1996 Negative interaction between the RelA(p65) subunit of NF-kappaB and the progesterone receptor.
7989520 1994 No evidence for the expression of the progesterone receptor on peripheral blood lymphocytes during pregnancy.
7983041 1994 Identification of phosphorylation sites unique to the B form of human progesterone receptor. In vitro phosphorylation by casein kinase II.
7481822 1995 Sequence and characterization of a coactivator for the steroid hormone receptor superfamily.
7476977 1995 Identification of a group of Ser-Pro motif hormone-inducible phosphorylation sites in the human progesterone receptor.
6849751 1983 The interaction of canrenone with oestrogen and progesterone receptors in human uterine cytosol.
3551956 1987 Complete amino acid sequence of the human progesterone receptor deduced from cloned cDNA.
2736623 1989 Mechanisms of nuclear localization of the progesterone receptor: evidence for interaction between monomers.
2328727 1990 Two distinct estrogen-regulated promoters generate transcripts encoding the two functionally different human progesterone receptor forms A and B.
1557371 1992 Ligand and DNA-dependent phosphorylation of human progesterone receptor in vitro.