Property Summary

Ligand Count 14
NCBI Gene PubMed Count 67
PubMed Score 526.55
PubTator Score 320.95

Knowledge Summary


No data available


  Disease (3)


  Differential Expression (8)

Disease log2 FC p
diabetes mellitus 1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 5.200 8.8e-04
lung adenocarcinoma -2.100 9.4e-06
lung cancer -3.700 2.6e-06
lung carcinoma -4.500 4.8e-24
non-small cell lung cancer -2.954 1.8e-11
psoriasis -1.300 4.9e-04
sarcoidosis -2.900 1.1e-02

Gene RIF (43)

AA Sequence

YLSSQNGQPLWILGDVFLRSYYSVYDLGNNRVGFATAA                                    351 - 388

Text Mined References (68)

PMID Year Title