Property Summary

NCBI Gene PubMed Count 65
PubMed Score 492.09
PubTator Score 320.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
non-small cell lung cancer -3.923 2.1e-16
intraductal papillary-mucinous adenoma (... 5.200 8.8e-04
lung cancer -3.700 2.6e-06
sarcoidosis -3.100 1.0e-02
diabetes mellitus 1.100 1.1e-03
lung adenocarcinoma -4.900 2.9e-11
lung carcinoma -4.500 4.8e-24
psoriasis -1.300 4.9e-04

Gene RIF (41)

PMID Text
26158864 Data show that SNP interactions among H. pylori-related genes PGC, PTPN11, and IL1B, are associated with susceptibility to gastric carcinogenesis.
25857852 Results suggest that rs9471643 CG and rs6458238 AG/AA genotypes have important roles in up-regulating PGC expression, which may partially explain why individuals with these favorable genotypes have decreased risks of getting gastric cancer.
25551587 The results highlight an important role of PGC rs3789210 and rs6939861 in altering susceptibility to atrophic gastritis and/or gastric cancer.
25028655 Pepsinogen II is a good marker of corpus morphological changes before and after H. pylori eradication.
24895149 High serum Pepsinogen II level is associ9ated with the progression of gastric precancerous lesions.
24586594 An interaction effect of pri-let-7a-1 rs10739971 polymorphism with ERCC6 rs1917799 polymorphism was observed for the risk of gastric cancer.
24284944 Pepsin and pepsinogen in middle ear effusion are probably caused by LPR and may be involved in the pathogenesis of OME.
24009139 High serum pepsinogen II is associated with gastric cancer development and activity of Helicobacter pylori-associated chronic gastritis.
23455381 PGC rs6458238, PGC rs4711690 and PTPN11 rs12229892 were associated with susceptibilities to atrophic gastritis and/or gastric cancer.
23326145 plasma PG II level significantly correlated with H. pylori-infected gastric cancer
23311720 Levels of pepsinogen/pepsin A and C are higher in the mouth swabs of infants with clinical gastroesophageal reflux.
23178618 Data suggest that subjects with higher PGI level, and PG I/II ratio are more likely to develop several dyspeptic symptoms.
23117263 The serum levels of PG II and G-17 were significantly higher in Changle than those in Fuan.
23047493 Data suggest that serum pepsinogen I/II ratio (pepsinogen A/C ratio) is correlated with diabetic nephropathy and thus may be a biological marker for degree of urinary albumin excretion in patients with type 2 diabetes.
22066020 Serum pepsinogens I (PGI) and II (PGII), gastrin 17 (G-17), and antibodies against whole H. pylori, or cytotoxin-associated gene A (CagA) antigen among 309 consecutive patients, were measured.[Pepsinogen I, Gastrin 17]
22066020 Serum pepsinogens I (PGI) and II (PGII), gastrin 17 (G-17), and antibodies against whole H. pylori, or cytotoxin-associated gene A (CagA) antigen among 309 consecutive patients, were measured.
21303408 Chinese patients with sPGII greater than 10.25 microg/L are at greater risk of various H. pylori-related gastropathies.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19731026 Decreased pepsinogen I/II ratio is a reliable marker for atrophy in the stomach corpus.
19624876 PGC gene insertion/deletion polymorphism is negatively related to PGC protein expression in gastric mucosa, but is not related to the serum PGC level.
19624876 Observational study of gene-disease association. (HuGE Navigator)
19173902 Pepsinogen C insertion/deletion polymorphism and Helicobacter pylori infection seem to present a positive interaction in the development of gastric cancer.
19173902 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19132389 The pepsinogen C gene polymorphism increases an individual's susceptibility to gastric cancer and its precancerous conditions
19132389 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18844222 pepsinogens may have a role in esophageal squamous dysplasia
18447628 role of an insertion/deletion polymorphism in the Pepsinogen C (PGC) gene in the clinical outcome of 172 breast cancer patients
18447628 Observational study of gene-disease association. (HuGE Navigator)
18256027 pepsinogen C has a role in SP-B proteolytic processing in alveolar type 2 cells
17559360 Helicobacter pylori eradication improves gastric histology and decreases serum gastrin, pepsinogen I and pepsinogen II levels in patients with duodenal ulcer.
17288837 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16937501 Observational study of gene-disease association. (HuGE Navigator)
16937501 pepsinogen C genetic variants have a role in gastric cancer
15688378 Higher levels of Pepsinogen II is associated with early gastric cancer
15503827 pepsinogen C may be expressed by uveal melanoma and suggest that this protein could be considered as a new, unfavorable prognostic factor in these tumors
15200883 Pepsinogen C can be a good indicator in the screening and diagnosis of precursor of gastric cancer and gastric cancer.
12759353 human cathelicidin antimicrobial peptide-18 in seminal plasma is processed to generate a 38-amino acid antimicrobial peptide ALL-38 by the prostate-derived protease gastricsin when incubated at a pH corresponding to the vaginal pH
12698190 results suggested that only the PGA/PGC ratio can be considered as a biomarker for precancerous lesions of the stomach
12508350 Observational study of gene-disease association. (HuGE Navigator)
12508350 These results suggest that there is some relation between pepsinogen C gene polymorphism and gastric cancer, and the person with homogenous allele 1 predisposes to gastric cancer more than those with other genotypes.
12128264 Pepsinogen C is expressed in a quarter of ovarian carcinomas and might identify a subset of patients with different prognosis

AA Sequence

MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMD      1 - 70
AAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLT     71 - 140
GFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVF    141 - 210
SVYLSNQQGSSGGAVVFGGVDSSLYTGQIYWAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTS    211 - 280
LLTVPQQYMSALLQATGAQEDEYGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPT    281 - 350
YLSSQNGQPLWILGDVFLRSYYSVYDLGNNRVGFATAA                                    351 - 388
//

Text Mined References (66)

PMID Year Title
26158864 2015 SNP interactions of Helicobacter pylori-related host genes PGC, PTPN11, IL1B, and TLR4 in susceptibility to gastric carcinogenesis.
25857852 2016 Polymorphic rs9471643 and rs6458238 upregulate PGC transcription and protein expression in overdominant or dominant models.
25551587 2014 PGC TagSNP and its interaction with H. pylori and relation with gene expression in susceptibility to gastric carcinogenesis.
25028655 2014 Pepsinogen II can be a potential surrogate marker of morphological changes in corpus before and after H. pylori eradication.
24895149 2015 Temporal changes in serum biomarkers and risk for progression of gastric precancerous lesions: a longitudinal study.
24586594 2014 The interaction effects of pri-let-7a-1 rs10739971 with PGC and ERCC6 gene polymorphisms in gastric cancer and atrophic gastritis.
24284944 2014 Role of pepsin and pepsinogen: linking laryngopharyngeal reflux with otitis media with effusion in children.
24009139 2014 Cancer development based on chronic active gastritis and resulting gastric atrophy as assessed by serum levels of pepsinogen and Helicobacter pylori antibody titer.
23455381 2013 Helicobacter pylori-related host gene polymorphisms associated with susceptibility of gastric carcinogenesis: a two-stage case-control study in Chinese.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23326145 2012 Serum pepsinogen II is a better diagnostic marker in gastric cancer.
23311720 2013 Detection of pepsin in mouth swab: correlation with clinical gastroesophageal reflux in preterm infants.
23178618 Examination of serum pepsinogen in functional dyspepsia.
23117263 2012 Serum pepsinogens, gastrin-17 and Helicobacter pylori antibody in the residents of two cities in china with distinct mortality rates of gastric cancer.
23047493 2013 Serum pepsinogen I/II ratio is correlated with albuminuria in patients with type 2 diabetes.
22066020 2011 Accuracy and cut-off values of pepsinogens I, II and gastrin 17 for diagnosis of gastric fundic atrophy: influence of gastritis.
21303408 2011 Serum pepsinogen II: a neglected but useful biomarker to differentiate between diseased and normal stomachs.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19731026 2009 The validity of a biomarker method for indirect detection of gastric mucosal atrophy versus standard histopathology.
19624876 2009 [Correlation of pepsinogen C (PGC) gene insertion/deletion polymorphism to PGC protein expression in gastric mucosa and serum].
19230047 2009 Serum biomarker tests are useful in delineating between patients with gastric atrophy and normal, healthy stomach.
19173902 2008 [Interaction between an insertion/deletion polymorphism in pepsinogen C and Helicobacter pylori infection in the development of gastric cancer].
19132389 2009 Impact of pepsinogen C polymorphism on individual susceptibility to gastric cancer and its precancerous conditions in a Northeast Chinese population.
18844222 2009 Serum pepsinogens and risk of esophageal squamous dysplasia.
18447628 2008 Overall survival in women with breast cancer: the influence of pepsinogen C gene polymorphism.
18416347 Serum pepsinogen I and II levels in various gastric disorders with special reference to their use as a screening test for carcinoma stomach.
18256027 2008 Pepsinogen C proteolytic processing of surfactant protein B.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17559360 2008 Helicobacter pylori eradication improves gastric histology and decreases serum gastrin, pepsinogen I and pepsinogen II levels in patients with duodenal ulcer.
17288837 2006 [Correlation between an insertion-deletion polymorphism in the pepsinogen C gene and gastric cancer as well as its precursors].
16995475 Helicobacter pylori infection, but not mucosal atrophy, significantly affects serum pepsinogen level after gastric cancer surgery.
16937501 2006 Gastric cancer in a Caucasian population: role of pepsinogen C genetic variants.
16842245 2006 The relation of pepsinogen group II (PGII) expression to intestinal metaplasia and gastric cancer.
15688378 2005 Histologic and serum risk markers for noncardia early gastric cancer.
15503827 Expression and clinical significance of pepsinogen C in uveal melanomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479977 2004 Clinical usefulness of serum pepsinogen II in the management of Helicobacter pylori infection.
15200883 2004 [Expression of pepsinogen C in gastric cancer and its precursor].
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14578117 2004 Pepsinogen C: a type 2 cell-specific protease.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12759353 2003 Processing of seminal plasma hCAP-18 to ALL-38 by gastricsin: a novel mechanism of generating antimicrobial peptides in vagina.
12698190 2003 Pepsinogen A, pepsinogen C, and gastrin as markers of atrophic chronic gastritis in European dyspeptics.
12508350 2003 Association between pepsinogen C gene polymorphism and genetic predisposition to gastric cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12128264 2002 Expression and clinical significance of pepsinogen C in epithelial ovarian carcinomas.
11915945 2002 Pepsinogens, progastricsins, and prochymosins: structure, function, evolution, and development.
9794784 1998 Mechanism of activation of the gastric aspartic proteinases: pepsinogen, progastricsin and prochymosin.
9421118 1997 Helicobacter pylori genotypes influence serum pepsinogen C levels.
9406551 1997 Structural characterization of activation 'intermediate 2' on the pathway to human gastricsin.
9267315 1997 Immunofluorometric assay of pepsinogen C and preliminary clinical applications.
8876968 1996 Purification of pepsinogens from human urine and electrophoretic analysis by caseogram print.
8322031 1993 Pepsinogen A and C serum levels in relation to acute NSAID-associated mucosal lesions in healthy volunteers.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7714902 1995 Crystal and molecular structures of human progastricsin at 1.62 A resolution.
6816595 1982 Human progastricsin. Analysis of intermediates during activation into gastricsin and determination of the amino acid sequence of the propart.
6794457 1981 Human prostatic gastricsinogen: the precursor of seminal fluid acid proteinase.
3335549 1988 Primary structure of human pepsinogen C gene.
3305135 1987 Gastric proteases in Barrett's esophagus.
2909526 1989 Human pepsinogen C (progastricsin). Isolation of cDNA clones, localization to chromosome 6, and sequence homology with pepsinogen A.
2612209 1989 Assignment of human pepsinogen C (PGC) gene to chromosome 6.
2567697 1989 Human pepsinogen C (progastricsin) polymorphism: evidence for a single locus located at 6p21.1-pter.
2515193 1989 A comparative study on the NH2-terminal amino acid sequences and some other properties of six isozymic forms of human pepsinogens and pepsins.
1906854 1991 Methylation and expression of human pepsinogen genes in normal tissues and their alteration in stomach cancer.
1280267 1992 Isolation and characterization of a pepsin C zymogen produced by human breast tissues.