Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary


No data available



  Differential Expression (4)

Disease log2 FC p
hepatocellular carcinoma 1.200 9.5e-05
intraductal papillary-mucinous adenoma (... 1.100 3.0e-03
osteosarcoma -1.675 4.8e-06
tuberculosis and treatment for 6 months -1.300 3.2e-04

 Compartment GO Term (1)

AA Sequence

TRCALCHSQTNTRCEKCQKGVHAKCFREYHIR                                          561 - 592

Text Mined References (7)

PMID Year Title