Property Summary

NCBI Gene PubMed Count 46
PubMed Score 104.39
PubTator Score 46.89

Knowledge Summary

Patent (6,378)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 2.1e-05
psoriasis -4.000 5.2e-06
osteosarcoma -3.628 1.7e-11
ependymoma 1.100 5.0e-06
intraductal papillary-mucinous adenoma (... -1.200 4.2e-03
lung cancer -2.800 3.2e-04
pancreatic cancer -1.200 1.0e-03

Protein-protein Interaction (3)

Gene RIF (6)

PMID Text
22923583 findings showed glycosylation inhibited PFK1 activity and redirected glucose flux through the pentose phosphate pathway, thereby conferring a selective growth advantage on cancer cells
22174317 HIV-1 Rev interacting protein, phosphofructokinase, liver (PFKL), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20602615 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854154 Knockdown of phosphofructokinase, liver (PFKL) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18254975 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANW      1 - 70
LSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGSLLEELV     71 - 140
AEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMGR    141 - 210
HCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVK    211 - 280
DLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLME    281 - 350
CVQMTKEVQKAMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS    351 - 420
AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESIVENIRIYGIH    421 - 490
ALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSAS    491 - 560
GTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVEHMTEKMKTDIQRGLVLRNEKC    561 - 630
HDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVF    631 - 700
ANAPDSACVIGLKKKAVAFSPVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVT    701 - 770
RRTLSMDKGF                                                                771 - 780
//

Text Mined References (51)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22923583 2012 Phosphofructokinase 1 glycosylation regulates cell growth and metabolism.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21505073 2011 The human AIRE gene at chromosome 21q22 is a genetic determinant for the predisposition to rheumatoid arthritis in Japanese population.
21269460 2011 Initial characterization of the human central proteome.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18254975 2008 Physiogenomic comparison of human fat loss in response to diets restrictive of carbohydrate or fat.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.
8931492 1996 Cellular distribution of 6-phosphofructo-1-kinase isoenzymes in rat brain.
8780720 1996 Isozyme analysis of human polymorphonuclear leukocyte phosphofructokinase from insulin resistant individuals.
8115399 1993 Gene dosage effects of PFKL in transfected PC12 cells.
7825568 1995 Functional expression of human mutant phosphofructokinase in yeast: genetic defects in French Canadian and Swiss patients with phosphofructokinase deficiency.
6455664 1981 Assignment of the human gene for liver-type 6-phosphofructokinase isozyme (PFKL) to chromosome 21 by using somatic cell hybrids and monoclonal anti-L antibody.
6451249 1981 Isozymes of human phosphofructokinase in blood cells and cultured cell lines: molecular and genetic evidence for a trigenic system.
6445244 1980 Isoenzymes of human phosphofructokinase.
6444721 1980 Isozymes of human phosphofructokinase: identification and subunit structural characterization of a new system.
6444532 1980 The molecular mechanism of the inherited phosphofructokinase deficiency associated with hemolysis and myopathy.
6238898 1984 Regional mapping of liver type 6 phosphofructokinase isoenzyme on chromosome 21.
6227635 1983 Heterogeneity of the molecular lesions in inherited phosphofructokinase deficiency.
2960695 1987 Characterization of the enzymatic defect in late-onset muscle phosphofructokinase deficiency. New subtype of glycogen storage disease type VII.
2952576 1987 Phosphofructokinase activity in fibroblasts aneuploid for chromosome 21.
2948503 1986 Genomic clones of the human liver-type phosphofructokinase.
2944814 1986 Regional assignment of human liver-type 6-phosphofructokinase to chromosome 21q22.3 by using somatic cell hybrids and a monoclonal anti-L antibody.
2902561 1988 A DNA polymorphism with KpnI of the human liver-type phosphofructokinase (PFKL) gene.
2822040 1987 Construction of a cDNA clone containing the entire coding region of the human liver-type phosphofructokinase.
2533063 1989 The primary structure of human liver type phosphofructokinase and its comparison with other types of PFK.
2139864 1990 The structure of the human liver-type phosphofructokinase gene.
1828296 1991 Dinucleotide repeat polymorphism at the human liver-type 6-phosphofructokinase (PFKL) gene.
1565613 1992 A contiguous Not I restriction map of band q22.3 of human chromosome 21.
1533471 1992 Gene dosage and Down's syndrome: metabolic and enzymatic changes in PC12 cells overexpressing transfected human liver-type phosphofructokinase.
1446073 1992 An estimate of the sequencing error frequency in the DNA sequence databases.
156693 1979 Phosphofructokinase (PFK) isozymes in man. I. Studies of adult human tissues.