Property Summary

NCBI Gene PubMed Count 25
PubMed Score 18.74
PubTator Score 20.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.105 1.0e-03
adrenocortical carcinoma 1.689 6.7e-03
intraductal papillary-mucinous adenoma (... -1.500 4.2e-03

Protein-protein Interaction (5)

Gene RIF (14)

PMID Text
27491149 The expression of PFKFB3, PFKFB4, NAMPT, and TSPAN13 is strongly up-regulated in pediatric glioma.
26221874 Inhibition of PFKFB4 suppresses glycolysis and proliferation of multiple human cancer cell lines.
25772235 PFKFB4 suppresses oxidative stress and p62 accumulation, without which autophagy is stimulated likely as a ROS detoxification response.
25115398 Data indicate that the PFKFB4 expressed in multiple transformed cells and tumors functions to synthesize F2,6BP.
22892400 PFKFB4 and HO-2 are expressed in a coordinated manner to maintain glucose homeostasis.
22811469 Data suggest that molecular mechanism by which dihydrotestosterone induces Pfkfb4 (and thus glycolysis) during spermatogenesis involves stimulation of Sertoli cells to secrete FGF-2 (fibroblast growth factor 2); study uses recombinant human Pfkfb4.
22576210 we found that the glycolytic enzyme PFKFB4 is essential for prostate cancer cell survival by maintaining the balance between the use of glucose for energy generation and the synthesis of antioxidants.
22056879 an essential role of PFKFB4 in the maintenance of brain cancer stem-like cells
21640852 Sulforaphane is a potent inducer of apoptosis in hepatocellular carcinoma cells via PFKFB4-inhibition pathways.
21396842 PFKFB4 has an important role in the progression of non-muscle-invasive bladder cancer (
17143338 PFKFB-4 and PFKFB-3 genes are expressed in gastric and pancreatic cancer cells, they strongly respond to hypoxia via a HIF-1alpha dependent mechanism and possibly have a significant role in the Warburg effect which is found in malignant cells
15925437 Overexpression of PFKFB-4 transcript levels in breast & colon malignant tumors correlates with enhanced expression of PFKFB-3, hypoxia-inducible factor(HIF)-1alpha & known HIF-1 dependent genes Glut1 & VEGF
15642344 A detailed analysis of the 5'-flanking region of human gene pfkfb4 using different 5'-deletion promoter constructs was carried out; this gene is activated by serum and chemical hypoxia whereas beta-estradiol decreases its expression.
15474002 Mechanisms of hypoxic regulation of PFKFB4 gene expression were studied in several cancer cell lines.

AA Sequence

MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLTRYLNWIGVPT      1 - 70
REFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSEEGGHVAVFDATNTTRERRAT     71 - 140
IFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLD    141 - 210
RDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGRE    211 - 280
FAKSLAQFISDQNIKDLKVWTSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFAL    281 - 350
RDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV    351 - 420
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ                         421 - 469
//

Text Mined References (27)

PMID Year Title
27491149 [EXPRESSION OF PFKFB, HK2, NAMPT, TSPAN13 AND HSPB8 GENES IN PEDIATRIC GLIOMA].
26221874 2015 Targeting the sugar metabolism of tumors with a first-in-class 6-phosphofructo-2-kinase (PFKFB4) inhibitor.
25772235 2015 Identification of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase as a novel autophagy regulator by high content shRNA screening.
25115398 2014 Fructose-2,6-bisphosphate synthesis by 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 (PFKFB4) is required for the glycolytic response to hypoxia and tumor growth.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22892400 2012 Coordinated expression of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 and heme oxygenase 2: evidence for a regulatory link between glycolysis and heme catabolism.
22811469 2012 Sertoli-secreted FGF-2 induces PFKFB4 isozyme expression in mouse spermatogenic cells by activation of the MEK/ERK/CREB pathway.
22576210 2012 Functional metabolic screen identifies 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 as an important regulator of prostate cancer cell survival.
22056879 2012 RNAi screening in glioma stem-like cells identifies PFKFB4 as a key molecule important for cancer cell survival.
21640852 2011 Sulforaphane induces apoptosis in human hepatic cancer cells through inhibition of 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase4, mediated by hypoxia inducible factor-1-dependent pathway.
21396842 PFKFB4 as a prognostic marker in non-muscle-invasive bladder cancer.
17143338 2006 Hypoxic regulation of PFKFB-3 and PFKFB-4 gene expression in gastric and pancreatic cancer cell lines and expression of PFKFB genes in gastric cancers.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16311927 2005 Splice isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase-4: expression and hypoxic regulation.
15925437 2005 Overexpression of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase-4 in the human breast and colon malignant tumors.
15896703 2005 The kinase activity of human brain 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase is regulated via inhibition by phosphoenolpyruvate.
15642344 2005 Specific expression of pfkfb4 gene in spermatogonia germ cells and analysis of its 5'-flanking region.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474002 2004 Hypoxia induces transcription of 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-4 gene via hypoxia-inducible factor-1alpha activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10095107 1999 Cloning, expression and chromosomal localization of a human testis 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase gene.
9464277 1998 Expression of human placental-type 6-phosphofructo-2-kinase/fructose 2,6-bisphosphatase in various cells and cell lines.
8830046 1996 Cloning of cDNA encoding for a novel isozyme of fructose 6-phosphate, 2-kinase/fructose 2,6-bisphosphatase from human placenta.
7574501 1995 6-Phosphofructo-2-kinase/fructose-2,6-bisphosphatase: a metabolic signaling enzyme.
2837207 1988 Molecular cloning, sequence analysis, and expression of a human liver cDNA coding for fructose-6-P,2-kinase:fructose-2,6-bisphosphatase.