Property Summary

NCBI Gene PubMed Count 15
PubMed Score 35.11
PubTator Score 14.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Corneal dystrophy 24 3.929 2.0

Expression

Gene RIF (4)

AA Sequence

MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG      1 - 70
EARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA                71 - 129
//

Text Mined References (20)

PMID Year Title