Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6UWS5
Symbols CSRP2BP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
22356826 Ortholog of fungal COX assembly protein PET117

AA Sequence

MSRSSKVVLGLSVLLTAATVAGVHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAERE      1 - 70
KMLLAKGSQKS                                                                71 - 81
//

Text Mined References (4)

PMID Year Title
22356826 2012 Iterative orthology prediction uncovers new mitochondrial proteins and identifies C12orf62 as the human ortholog of COX14, a protein involved in the assembly of cytochrome c oxidase.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.