Property Summary

NCBI Gene PubMed Count 15
PubMed Score 41.45
PubTator Score 29.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic cancer 1.200 6.9e-04
osteosarcoma -3.242 7.2e-04
non-small cell lung cancer -1.308 1.7e-18
breast carcinoma -1.100 3.1e-05
pancreatic carcinoma 1.200 6.9e-04
lung adenocarcinoma -1.100 2.3e-15
invasive ductal carcinoma -2.000 1.3e-04
ductal carcinoma in situ -1.200 3.7e-04

Gene RIF (16)

PMID Text
26406321 Results suggest that genetic variation of PEAR1 is a significant determinant of endothelial function through pathways implicated in cardiovascular disease.
26156496 Platelet endothelial aggregation receptor-1: a novel modifier of neoangiogenesis.
25713122 FcepsilonRI alpha-chain is an activating platelet endothelium aggregation receptor 1 (PEAR1) ligand.
25703520 genetic variability of GAS6 and PEAR1 genes may be associated with platelet hyperaggregability
25541647 study suggests that PEAR1 is not a hypertension susceptibility gene in humans.
25360888 A common genetic variant in PEAR1 (rs12041331) reproducibly influenced platelet aggregation in aspirin-treated patients with coronary artery disease.
23859572 The SNPs in two regions of the PEAR1 gene, from rs3737224 to rs822442, and from rs1214331 to rs12566888, probably play important roles in prasugrel pharmacodynamics
23704978 additional exonic variants in PEAR1 that may also determine variability in platelet aggregation, were identified.
23667054 PEAR1 attenuates megakaryopoiesis via control of the PI3K/PTEN pathway.
23392654 A-allele carriers of rs12041331 in the platelet endothelial aggregation receptor-1 (PEAR1) gene were more likely to experience a cardiovascular event or death compared with GG homozygotes
21791418 A specific intronic PEAR1 gene variant is ientified that associated with greater platelet aggregability and protein expression.
20526338 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19429868 Observational study of gene-disease association. (HuGE Navigator)
18511696 C allele of PEAR1 (Platelet endothelial aggregation receptor-1)was generally associated in both ethnic groups with increased aggregation of native platelets
18511696 Observational study of gene-disease association. (HuGE Navigator)
15851471 PEAR1 is a novel platelet receptor that signals secondary to alpha(IIb)beta(3)-mediated platelet-platelet contacts

AA Sequence

MSPPLCPLLLLAVGLRLAGTLNPSDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTV      1 - 70
VYRTVYRQVVKTDHRQRLQCCHGFYESRGFCVPLCAQECVHGRCVAPNQCQCVPGWRGDDCSSECAPGMW     71 - 140
GPQCDKPCSCGNNSSCDPKSGVCSCPSGLQPPNCLQPCTPGYYGPACQFRCQCHGAPCDPQTGACFCPAE    141 - 210
RTGPSCDVSCSQGTSGFFCPSTHSCQNGGVFQTPQGSCSCPPGWMGTICSLPCPEGFHGPNCSQECRCHN    211 - 280
GGLCDRFTGQCRCAPGYTGDRCREECPVGRFGQDCAETCDCAPDARCFPANGACLCEHGFTGDRCTDRLC    281 - 350
PDGFYGLSCQAPCTCDREHSLSCHPMNGECSCLPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQATS    351 - 420
GLCQCAPGYTGPHCASLCPPDTYGVNCSARCSCENAIACSPIDGECVCKEGWQRGNCSVPCPPGTWGFSC    421 - 490
NASCQCAHEAVCSPQTGACTCTPGWHGAHCQLPCPKGQFGEGCASRCDCDHSDGCDPVHGRCQCQAGWMG    491 - 560
ARCHLSCPEGLWGVNCSNTCTCKNGGTCLPENGNCVCAPGFRGPSCQRSCQPGRYGKRCVPCKCANHSFC    561 - 630
HPSNGTCYCLAGWTGPDCSQPCPPGHWGENCAQTCQCHHGGTCHPQDGSCICPLGWTGHHCLEGCPLGTF    631 - 700
GANCSQPCQCGPGEKCHPETGACVCPPGHSGAPCRIGIQEPFTVMPTTPVAYNSLGAVIGIAVLGSLVVA    701 - 770
LVALFIGYRHWQKGKEHHHLAVAYSSGRLDGSEYVMPDVPPSYSHYYSNPSYHTLSQCSPNPPPPNKVPG    771 - 840
PLFASLQNPERPGGAQGHDNHTTLPADWKHRREPPPGPLDRGSSRLDRSYSYSYSNGPGPFYNKGLISEE    841 - 910
ELGASVASLSSENPYATIRDLPSLPGGPRESSYMEMKGPPSGSPPRQPPQFWDSQRRRQPQPQRDSGTYE    911 - 980
QPSPLIHDRDSVGSQPPLPPGLPPGHYDSPKNSHIPGHYDLPPVRHPPSPPLRRQDR                 981 - 1037
//

Text Mined References (16)

PMID Year Title
26406321 2015 Genetic Variation in the Platelet Endothelial Aggregation Receptor 1 Gene Results in Endothelial Dysfunction.
26156496 2015 Platelet endothelial aggregation receptor-1: a novel modifier of neoangiogenesis.
25713122 2015 A Human Platelet Receptor Protein Microarray Identifies the High Affinity Immunoglobulin E Receptor Subunit ? (Fc?R1?) as an Activating Platelet Endothelium Aggregation Receptor 1 (PEAR1) Ligand.
25703520 2015 Different models of inheritance in selected genes in patients with sticky platelet syndrome and fetal loss.
25541647 2015 PEAR1 is not a human hypertension-susceptibility gene.
25360888 2014 Genetic determinants of on-aspirin platelet reactivity: focus on the influence of PEAR1.
23859572 2013 Identification of PEAR1 SNPs and their influences on the variation in prasugrel pharmacodynamics.
23704978 2013 Targeted deep resequencing identifies coding variants in the PEAR1 gene that play a role in platelet aggregation.
23667054 2013 PEAR1 attenuates megakaryopoiesis via control of the PI3K/PTEN pathway.
23392654 2013 Genetic variation in PEAR1 is associated with platelet aggregation and cardiovascular outcomes.
21791418 2011 Identification of a specific intronic PEAR1 gene variant associated with greater platelet aggregability and protein expression.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
19429868 2009 A functional genomics approach reveals novel quantitative trait loci associated with platelet signaling pathways.
18511696 2008 A novel variant in the platelet endothelial aggregation receptor-1 gene is associated with increased platelet aggregability.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15851471 2005 Platelet endothelial aggregation receptor 1 (PEAR1), a novel epidermal growth factor repeat-containing transmembrane receptor, participates in platelet contact-induced activation.