Property Summary

NCBI Gene PubMed Count 27
PubMed Score 163.89
PubTator Score 413.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
pancreatic cancer -1.100 6.6e-05
malignant mesothelioma 1.100 2.3e-04
astrocytic glioma -1.900 1.8e-03
ependymoma -2.400 3.0e-03
oligodendroglioma -1.900 1.5e-02
glioblastoma -2.100 2.8e-03
osteosarcoma 2.896 6.4e-08
medulloblastoma -2.400 1.1e-05
atypical teratoid / rhabdoid tumor -2.800 6.0e-09
medulloblastoma, large-cell -2.900 6.0e-04
primitive neuroectodermal tumor -1.400 1.4e-02
Duchenne muscular dystrophy -1.254 6.9e-05
limb girdle muscular dystrophy 2I -1.046 1.1e-02
autosomal dominant Emery-Dreifuss muscul... -1.414 1.1e-02
Becker muscular dystrophy -1.026 2.7e-02
juvenile dermatomyositis -1.115 4.7e-06
acute quadriplegic myopathy -1.588 2.1e-04
intraductal papillary-mucinous neoplasm ... 1.600 3.8e-02
Parkinson's disease -1.600 2.0e-02
adult high grade glioma -1.800 1.3e-02
pilocytic astrocytoma -1.600 2.6e-03
pancreatic carcinoma -1.100 6.6e-05
ulcerative colitis 2.100 1.8e-03
ovarian cancer 1.500 1.3e-04
head and neck cancer and chronic obstruc... -1.200 2.2e-02

Gene RIF (11)

PMID Text
24962578 YB-1 phosphorylation at Ser-102 is an important prerequisite for CCL5 promoter activation during macrophage differentiation
24486017 the pyruvate dehydrogenase complex is regulated by Tyr phosphorylation of PDP1, which toggles recruitment between ACAT1 and SIRT3
21680880 Although 7 days of bed rest induced whole body glucose intolerance, exercise-induced PDH regulation in skeletal muscle was not changed, suggesting that exercise-induced PDH regulation in skeletal muscle is maintained in glucose-intolerant individuals.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20208177 catalytic subunit of PDP1 crystals belonged to space group P4(1)2(1)2 or P4(3)2(1)2, with unit-cell parameters a = b = 65.1, c = 216.1 A.
16188909 Lower accumulation of free ADP and AMP after the FAT-adapt trial may be responsible for the decreased glycogenolysis and PDH activation during sprinting.
15897476 pyruvate dehydrogenase phosphatase PDP1 is down-regulated in circulating lymphocytes of obese subjects because it is poorly sensitive to magnesium/calcium; this defect is attenuated when plasma insulin is greatly enhanced
9651365 Functional characterization of the rat counterpart.
8396421 Functional characterization of the bovine counterpart.
1327585 In cultured skin fibroblasts from three patients with congenital lactic acidemia due to a defect in activation of the pyruvate dehydrogenase complex, the PDP-activity was significantly reduced to 50.7%, 64.6% and 63.1% of that of control fibroblasts.
172850 In postmortem tissue samples, from male child with metabolic acidosis, PDK normally reduced PDH-activity in ATP-presence. Addition of Ca++ and Mg++ did not restored PDH-activity. The defect was attributed to a markedly reduced PDP-activity.

AA Sequence

MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRR      1 - 70
YASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLL     71 - 140
GVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFN    141 - 210
SLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVD    211 - 280
GVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKSEAKSVVKQDRLLGLLMPF    281 - 350
RAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGL    351 - 420
WETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRTKMSSVFEDQNAATHLIRHAVGNN    421 - 490
EFGTVDHERLSKMLSLPEELARMYRDDITIIVVQFNSHVVGAYQNQE                           491 - 537
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24962578 2014 Tyr-94 phosphorylation inhibits pyruvate dehydrogenase phosphatase 1 and promotes tumor growth.
24486017 2014 Tyr phosphorylation of PDP1 toggles recruitment between ACAT1 and SIRT3 to regulate the pyruvate dehydrogenase complex.
21680880 2011 Exercise-induced pyruvate dehydrogenase activation is not affected by 7 days of bed rest.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20801214 2011 Ppm1E is an in cellulo AMP-activated protein kinase phosphatase.
20208177 2010 Crystallization and preliminary crystallographic studies of the catalytic subunits of human pyruvate dehydrogenase phosphatase isoforms 1 and 2.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19184109 2009 Pyruvate dehydrogenase phosphatase 1 (PDP1) null mutation produces a lethal infantile phenotype.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16188909 2006 Decreased PDH activation and glycogenolysis during exercise following fat adaptation with carbohydrate restoration.
15897476 2005 Down-regulation of pyruvate dehydrogenase phosphatase in obese subjects is a defect that signals insulin resistance.
15855260 2005 Pyruvate dehydrogenase phosphatase deficiency: identification of the first mutation in two brothers and restoration of activity by protein complementation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527413 2003 Nonsense-mediated mRNA decay in mammalian cells involves decapping, deadenylating, and exonucleolytic activities.
12676647 2003 Recent advances in mechanisms regulating glucose oxidation at the level of the pyruvate dehydrogenase complex by PDKs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11577086 2001 Activation and mitochondrial translocation of protein kinase Cdelta are necessary for insulin stimulation of pyruvate dehydrogenase complex activity in muscle and liver cells.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9651365 1998 Isoenzymes of pyruvate dehydrogenase phosphatase. DNA-derived amino acid sequences, expression, and regulation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8396421 1993 Molecular cloning and expression of the catalytic subunit of bovine pyruvate dehydrogenase phosphatase and sequence similarity with protein phosphatase 2C.
7782287 1995 Mutagenesis studies of the phosphorylation sites of recombinant human pyruvate dehydrogenase. Site-specific regulation.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
1327585 1992 Decrease of pyruvate dehydrogenase phosphatase activity in patients with congenital lactic acidemia.
172850 1975 Pyruvate dehydrogenase phosphatase deficiency: a cause of congenital chronic lactic acidosis in infancy.