Property Summary

NCBI Gene PubMed Count 61
PubMed Score 43.25
PubTator Score 376.74

Knowledge Summary

Patent

No data available

Expression

Gene RIF (66)

PMID Text
25664880 It was found that PDI interacts with dengue virus nonstructural protein 1 (NS1) intracellularly as well as on the surface in the lipid raft domain.
25631539 Tissue factor-regulated vascular smooth cell migration and microvessel formation is under the control of the ER-protein PDIA2.
25419565 Data show that cell surface disulfide isomerase (PDI) expression and function regulate the capacity of natriuretic peptides to generate cyclic guanosine monophosphate (cGMP) through interaction with their receptors.
25122773 These results indicate that BPA, a widely distributed and potentially harmful chemical, inhibits Ero1-PDI-mediated disulfide bond formation.
24967714 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
24415753 PDI appears to regulate cytoskeletal reorganization by the thiol-disulfide exchange in beta-actin via a redox-dependent mechanism.
23979138 Data indicate that protein disulfide isomerase (PDI) and ERp44 dynamically localize Ero1alpha and peroxiredoxin 4 in early secretory compartment (ESC).
23454490 GPx7 is an unusual CysGPx catalyzing the peroxidatic cycle by a one Cys mechanism in which GSH and PDI are alternative substrates.
23206338 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
23167757 Human major histocompatibility complex class 1 antigens (HLA-A,B,C) are potential binding partners of PDIA2, suggesting an involvement for PDIA2 in antigen presentation.
22773830 PDI is required to support Nox1/redox and GTPase-dependent VSMC migration.
22685557 Data indicate that apoptosis induced by misfolded PrP proteins could be regulated by protein disulfide isomerase (PDI) via mitochondrial dysfunction.
22657537 The redox-regulated open/closed conformational switch of hPDI endows the protein with versatile target-binding capacities for its enzymatic and chaperone functions.
22230366 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
22105075 PDI exhibits unfoldase activity for proinsulin, increasing retention of proinsulin within the ER of pancreatic beta-cells
22090031 mechanistic insights into the redox-regulated chaperone activity of human PDI.
21929690 surface-associated PDI is an important regulator of coagulation factor ligation to thrombin-stimulated platelets and of subsequent feedback activation of platelet thrombin generation
21791598 tein disulfide isomerase redox-dependent association with p47(phox): evidence for an organizer role in leukocyte NADPH oxidase activation.
21757736 the intramolecular electron transfer from the a domain to the a' domain within PDI during its oxidation by ERO1alpha.
21637911 Data show that diabetic patients had a greater number of transferase-mediated dUTP nick-end labeling-positive cells than nondiabetic patients despite a greater myocardial protein disulfide isomerase (PDI)expression suggesting altered PDI function.
21471526 Protein disulfide isomerase blocks CEBPA translation and is up-regulated during the unfolded protein response in acute myeloid leukemia.
21297336 PDI knockdown-induced cell death is cell-line-dependent and involves apoptosis in MCF-7 cells.
21121641 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
21080683 The hydrogen bond, formed between the 3-hydroxyl group of Estradiol (E(2)) (donor) and pancreas-specific protein disulfide isomerase's His278 (acceptor), is indispensable for its binding.
20886095 PDI is a major target of post-streptococcal autoimmunity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20562109 Ero1alpha is expressed on blood platelets in association with protein-disulfide isomerase and contributes to redox-controlled remodeling of alphaIIbbeta3.
20550946 These results suggest that PDI could be a therapeutic target to prevent ER stress in neuronal cells in Alzheimer disease.
20516074 Plasticity of human protein disulfide isomerase: evidence for mobility around the X-linker region and its functional significance.
20458450 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
20448108 new mechanism for PDI contribution to coagulation on endothelial cells, namely, the regulation of PS exposure, where PDI acts as a negative regulator of coagulation
20423326 Selective expression of pancreas-specific protein disulfide-isomerase confers strong protection against heat shock and oxidative-stress-induced cell death.
20368688 Among target genes of XBP-1, expression of protein disulfide isomerase (PDI), but not glucose- regulated protein 78 (GRP78), was increased in AD
20202930 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
20163832 PDI has a role in regulating tissue factor that involves FVIIa activity [review]
20130085 an appropriate Ero1alpha-PDI ratio is critical for regulating the binding-release cycle of CTA1 by PDI during retro-translocation, and PDI's redox state has a role in targeting it to the retro-translocon
20098615 A haplotype within the AXIN1-PDIA2 locus (p-value of 2.926x10(-06)) and a haplotype within the Endoglin gene (p-value of 5.881x10(-04)) were found to be strongly associated with bicuspid aortic valve
20098615 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19844948 The b domain of human PDI tends to form homodimers - both in isolation and in other contexts. This tendency is moderated by the adjacent x region, which can bind to a surface patch on the b domain.
19821078 The absence of PDIp expression in pancreatic adenocarcinoma may serve as an additional biomarker for pancreatic cancer.
19805615 the majority of PDI in platelets is intracellular where it is exclusively located in the dense tubular system
19636846 The b' domain of PDI contributes to binding unfolded proteins; its structure is stabilized by the b domain.
19429457 PDIp can also serve as an effective modulator of the cellular levels and biological actions of endogenous estrogens in the pancreas where estrogen receptors alpha and beta and PDIp are co-present.
19187238 the solution structure of the second and third domains of human protein disulfide isomerase (b and b', respectively) by triple-resonance NMR spectroscopy and molecular modeling
19150607 structures and functions of human PDIp are redox-regulated through formation of an inter-subunit disulfide bond between two cysteine-4 residues
19103594 a role for both GRP78 and PDI in insulin biosynthesis, although an excess of PDI disrupts normal proinsulin processing.
19038358 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
18801374 The x region of PDI can adopt alternative conformations during the functional cycle of PDI action and that these are linked to the ability of PDI to interact with folding substrates.
18691554 Platelet microparticle-associated PDI promotes platelet aggregation and inactivates insulin.
18508857 Study shows that SUMF1 interacts with protein disulfide isomerase (PDI) and ERp44, two thioredoxin family members residing in the early secretory pathway, and with ERGIC-53, a lectin that shuttles between the ER and the Golgi.
17978580 These data indicate that cytosolic PDI is a substrate of caspase-3 and -7, and that it has an anti-apoptotic action.
17301129 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
17055437 PDI stabilizes a peptide-receptive site by regulating oxidation state of the disulfide bond in MHC peptide-binding groove, an essential function for selecting optimal peptides; link between thiol-based redox regulation & antigen processing established
16677073 Ero1alpha and Ero1beta are retained in the endoplasmic reticulum by interactions with PDI and ERp44
16507315 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
16407203 Low resolution structure of the entire PDI molecule in solution has been determined for the first time by the small angle X-ray scattering technique
15225124 Protein disulphide-isomerase is responsible for the reductive separation of ricin into its A and B chains in the mammalian endoplasmic reticulum.
14684740 study of the principal substrate binding site of PDI
14592831 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
12766950 PDI has a role in conferring resistance to apoptosis under hypoxia and a potential role in the oxygen-sensing apparatus
12485997 dissociation of PDI from substrates observed in the presence of glutathione disulfide can be explained by competition for the peptide-binding site on PDI
12218052 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
12218051 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
12095988 role of association with ubiquilin in the endoplasmic reticulum in stress-induced apoptotic cell death
11968009 Evidence that protein disulfide isomerase (PDI) is involved in DNA-nuclear matrix anchoring.

AA Sequence

MSRQLLPVLLLLLLRASCPWGQEQGARSPSEEPPEEEIPKEDGILVLSRHTLGLALREHPALLVEFYAPW      1 - 70
CGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTLKFFRNGNRTHPEEYTGPRDA     71 - 140
EGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRL    141 - 210
FQQFGLTKDTVVLFKKFDEGRADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLL    211 - 280
LFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPV    281 - 350
DGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTH    351 - 420
CKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKF    421 - 490
LDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL                                       491 - 525
//

Text Mined References (65)

PMID Year Title
25664880 2015 Protein disulfide isomerase mediates dengue virus entry in association with lipid rafts.
25631539 2015 Protein disulphide-isomerase A2 regulated intracellular tissue factor mobilisation in migrating human vascular smooth muscle cells.
25419565 2014 Cell surface protein disulfide isomerase regulates natriuretic peptide generation of cyclic guanosine monophosphate.
25122773 2014 Inhibition of the functional interplay between endoplasmic reticulum (ER) oxidoreduclin-1? (Ero1?) and protein-disulfide isomerase (PDI) by the endocrine disruptor bisphenol A.
24415753 2014 Protein disulfide isomerase directly interacts with ?-actin Cys374 and regulates cytoskeleton reorganization.
23979138 2013 Dynamic regulation of Ero1? and peroxiredoxin 4 localization in the secretory pathway.
23454490 2013 Protein disulfide isomerase and glutathione are alternative substrates in the one Cys catalytic cycle of glutathione peroxidase 7.
23167757 2013 N-linked glycosylation modulates dimerization of protein disulfide isomerase family A member 2 (PDIA2).
22773830 2012 Protein disulfide isomerase is required for platelet-derived growth factor-induced vascular smooth muscle cell migration, Nox1 NADPH oxidase expression, and RhoGTPase activation.
22685557 2012 Protein disulfide isomerase regulates endoplasmic reticulum stress and the apoptotic process during prion infection and PrP mutant-induced cytotoxicity.
22657537 2013 Structural insights into the redox-regulated dynamic conformations of human protein disulfide isomerase.
22105075 2012 Action of protein disulfide isomerase on proinsulin exit from endoplasmic reticulum of pancreatic ?-cells.
22090031 2012 Human protein-disulfide isomerase is a redox-regulated chaperone activated by oxidation of domain a'.
22013210 2011 The unfolded protein response: integrating stress signals through the stress sensor IRE1?.
21929690 2011 Extracellular protein disulfide isomerase regulates feedback activation of platelet thrombin generation via modulation of coagulation factor binding.
21791598 2011 Protein disulfide isomerase redox-dependent association with p47(phox): evidence for an organizer role in leukocyte NADPH oxidase activation.
21757736 2011 Functional in vitro analysis of the ERO1 protein and protein-disulfide isomerase pathway.
21637911 Altered oxido-reductive state in the diabetic heart: loss of cardioprotection due to protein disulfide isomerase.
21471526 2011 Protein disulfide isomerase blocks CEBPA translation and is up-regulated during the unfolded protein response in AML.
21297336 2011 Protein disulfide isomerase knockdown-induced cell death is cell-line-dependent and involves apoptosis in MCF-7 cells.
21080683 2011 Characterization of the estradiol-binding site structure of human pancreas-specific protein disulfide isomerase: indispensable role of the hydrogen bond between His278 and the estradiol 3-hydroxyl group.
20886095 2010 Post-streptococcal auto-antibodies inhibit protein disulfide isomerase and are associated with insulin resistance.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20562109 2010 Ero1alpha is expressed on blood platelets in association with protein-disulfide isomerase and contributes to redox-controlled remodeling of alphaIIbbeta3.
20550946 2010 Protein disulfide isomerase-immunopositive inclusions in patients with Alzheimer disease.
20516074 2010 Plasticity of human protein disulfide isomerase: evidence for mobility around the X-linker region and its functional significance.
20448108 2010 Extracellular protein disulfide isomerase regulates coagulation on endothelial cells through modulation of phosphatidylserine exposure.
20423326 2010 Human pancreas-specific protein disulfide-isomerase (PDIp) can function as a chaperone independently of its enzymatic activity by forming stable complexes with denatured substrate proteins.
20368688 2010 Induction of the unfolded protein response and cell death pathway in Alzheimer's disease, but not in aged Tg2576 mice.
20163832 2010 Role of PDI in regulating tissue factor: FVIIa activity.
20130085 2010 The Ero1alpha-PDI redox cycle regulates retro-translocation of cholera toxin.
20098615 2010 Application of gene network analysis techniques identifies AXIN1/PDIA2 and endoglin haplotypes associated with bicuspid aortic valve.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19844948 2009 The ligand-binding b' domain of human protein disulphide-isomerase mediates homodimerization.
19821078 2009 Pancreas-specific protein disulfide isomerase has a cell type-specific expression in various mouse tissues and is absent in human pancreatic adenocarcinoma cells: implications for its functions.
19805615 2009 Platelet protein disulfide isomerase is localized in the dense tubular system and does not become surface expressed after activation.
19636846 2007 1H, 13C and 15N resonance assignments of the bb' domains of human protein disulfide isomerase.
19429457 2009 Human pancreas-specific protein disulfide isomerase homolog (PDIp) is an intracellular estrogen-binding protein that modulates estrogen levels and actions in target cells.
19187238 2009 Solution structure of the bb' domains of human protein disulfide isomerase.
19150607 2009 Human pancreas-specific protein disulfide isomerase homolog (PDIp) is redox-regulated through formation of an inter-subunit disulfide bond.
19103594 2009 GRP78, but Not Protein-disulfide Isomerase, Partially Reverses Hyperglycemia-induced Inhibition of Insulin Synthesis and Secretion in Pancreatic {beta}-Cells.
18801374 2008 Alternative conformations of the x region of human protein disulphide-isomerase modulate exposure of the substrate binding b' domain.
18691554 2008 Platelet microparticle-associated protein disulfide isomerase promotes platelet aggregation and inactivates insulin.
18508857 2008 Multistep, sequential control of the trafficking and function of the multiple sulfatase deficiency gene product, SUMF1 by PDI, ERGIC-53 and ERp44.
17978580 2007 Protein disulfide isomerase is cleaved by caspase-3 and -7 during apoptosis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17055437 2006 Redox regulation facilitates optimal peptide selection by MHC class I during antigen processing.
16677073 Dynamic retention of Ero1alpha and Ero1beta in the endoplasmic reticulum by interactions with PDI and ERp44.
16407203 2006 Annular arrangement and collaborative actions of four domains of protein-disulfide isomerase: a small angle X-ray scattering study in solution.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225124 2004 Protein disulphide-isomerase reduces ricin to its A and B chains in the endoplasmic reticulum.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684740 2004 Molecular characterization of the principal substrate binding site of the ubiquitous folding catalyst protein disulfide isomerase.
12766950 2003 The thioredoxin-like fold: hidden domains in protein disulfide isomerases and other chaperone proteins.
12485997 2002 Is protein disulfide isomerase a redox-dependent molecular chaperone?
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475965 2002 A subset of chaperones and folding enzymes form multiprotein complexes in endoplasmic reticulum to bind nascent proteins.
12095988 2002 Role of ubiquilin associated with protein-disulfide isomerase in the endoplasmic reticulum in stress-induced apoptotic cell death.
11968009 2002 Evidence that protein disulfide isomerase (PDI) is involved in DNA-nuclear matrix anchoring.
11488911 2001 Thermodynamics of the folding of D-glyceraldehyde-3-phosphate dehydrogenase assisted by protein disulfide isomerase studied by microcalorimetry.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
9115635 1997 Molecular characterization of a pancreas-specific protein disulfide isomerase, PDIp.
8561901 1996 Characterization and chromosomal localization of a new protein disulfide isomerase, PDIp, highly expressed in human pancreas.