Property Summary

NCBI Gene PubMed Count 395
PubMed Score 753.05
PubTator Score 1015.31

Knowledge Summary

Patent (32,454)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Connective tissue cancer 9 0.0 2.0
Disease Target Count Z-score Confidence
Globe disease 57 0.0 2.0
Refractive error 43 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 5.746 2.9

Expression

  Differential Expression (31)

Disease log2 FC p
malignant mesothelioma -5.600 1.9e-09
astrocytic glioma 1.600 2.0e-02
oligodendroglioma 2.500 1.5e-02
psoriasis -1.100 6.8e-04
osteosarcoma 1.117 5.3e-03
glioblastoma 2.000 5.4e-03
cystic fibrosis -2.882 1.3e-06
medulloblastoma, large-cell -2.700 6.6e-04
Duchenne muscular dystrophy 1.680 3.5e-07
autosomal dominant Emery-Dreifuss muscul... 1.003 4.1e-02
Atopic dermatitis -1.400 6.4e-03
adrenocortical adenoma -1.433 1.6e-02
adrenocortical carcinoma -4.049 1.5e-06
primary pancreatic ductal adenocarcinoma 1.843 6.7e-03
intraductal papillary-mucinous carcinoma... -2.500 2.7e-02
intraductal papillary-mucinous neoplasm ... -4.200 2.1e-03
colon cancer -1.900 1.1e-02
lung cancer -1.500 2.0e-04
breast carcinoma -1.600 7.7e-25
group 3 medulloblastoma -2.300 3.9e-02
pilocytic astrocytoma 3.500 1.3e-07
primary Sjogren syndrome 1.100 8.3e-03
lung adenocarcinoma -1.600 2.7e-08
Breast cancer -2.800 1.3e-12
lung carcinoma -2.700 1.9e-20
ductal carcinoma in situ -1.100 3.5e-03
invasive ductal carcinoma -1.900 8.8e-05
ulcerative colitis 1.800 4.1e-04
ovarian cancer -4.400 3.6e-10
pituitary cancer -3.900 1.3e-13
pancreatic cancer 1.800 4.5e-03

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (345)

PMID Text
26867653 Our data support those recently published in a meta-analysis on 1487 patients proving that GISTs bearing KIT mutations have a significantly poorer prognosis than either PDGFRA mutated or WT GISTs
26772734 we retrospectively examined correlations between clinical outcomes and KIT/PDGFRA mutational status in a subset of imatinib-resistant or -intolerant patients with stromal tumor participating in a worldwide, open-label treatment-use study
26544626 Data characterized metastatic exon 11 mutant gastrointestinal stromal tumors (GIST) genetic susceptibility genes beyond kit proto-oncogene protein (KIT)/PDGF alpha receptor (PDGFRalpha) genotype.
26297547 miR-140-5p acts as a tumor suppressor during ovarian carcinogenesis, inhibiting ovarian cancer growth partially by repressing PDGFRA expression.
26284551 Platelet-derived growth factor-BB enhances adipogenesis in orbital fibroblasts, and, thus, may contribute to adipose tissue expansion in GO.
26191304 Case Report/Review: PDGFRA exon 18 mutation in myxoid epithelioid gastrointestinal stromal tumor.
26191303 case Report/Review: therapy-related acute myeloid leukemia with t(4:14)(q12;q24) and PDGFRA gene rearrangement.
26191287 16.0% of the gastrointestinal stromal tumors samples studied had a mutation in PDGFRA
26189259 Microarray data of the expression level of key genes reveals that PDGFRA is critical for cervical cancer invasion and metastasis.
25970686 KIT-mutated patients had a worse outcome than PDGFRA-mutated or triple-negative (KIT, PDGFRA, BRAF wild-type) cases
25936870 In conclusion, mutations in the PDGFRa gene was independent of the viral positivity and may represent an independent factor in Merkel cell carcinoma development.
25880691 STAT mediated responses are an integral part of mutated PDGFRalpha signalling.
25748235 Thus, malignant transformation into intratubular germ cell neoplasia is likely to occur after the migration of PGCs. We reveal possible drivers of TGCT pathogenesis, such as mutated PDGFRA, potentially with therapeutic implications for TGCT patients.
25744030 observations suggest that NRP-1 is involved in megakaryocytopoiesis through complex formation with PDGFRs, and that NRP-1-PDGFR-complexes may contribute to effective cellular functions mediated by thrombopoietin and PDGF in megakaryocytic cells
25700367 We will also briefly discuss some of the current targeted treatments for PDGFRa, including multi receptor tyrosine kinase inhibitors and PDGFRa-specific inhibitors
25674291 Case Report: synchronous poorly-differentiated neuroendocrine carcinoma and gastrointestinal stromal tumor of the stomach expression PDGFRA protein free of mutations.
25659388 This study identified KIT and PDGFRA mutations in 21 out of 25 gastrointestinal stromal tumor samples from 2 referential national hospitals in Peru.
25621775 PDGFRA genes mutations detected before the start of therapy that are related to GIST pathogenesis and some secondary mutations causing drug resistance and progression of disease.
25605837 Authors identified 301 different single mutations in KIT and 33 in PDGFRA. Patients with PDGFRA mutations had more favorable recurrence free survival than those with KIT mutations (hazard ratio, 0.34; P = .004).
25502837 PDGFRalpha and beta can be directly regulated by Foxq1 or indirectly regulated through the Foxq1/Twist1 axis
25481675 The current study identified novel KIT and PDGFRA gene mutations that added new insights into the genetic heterogeneity of gastrointestinal stromal tumors
25425645 MCM7 is essential for RNA splicing of epidermal growth factor receptor, c-Met, and platelet-derived growth factor receptor
25380967 The rationale for simultaneous targeting of EGFR and PDGFR.
25333264 plays a critical role in hepatocellular carcinoma progression and prognosis
25323095 There were statistically significant correlations between the expression of PDGFR-alpha, c-Met, and EGFR and disease-free survival
25202099 Sorafenib activity seems independent from the c-KIT and PDGFR-alpha mutational status.
25169976 PDGF receptor-alpha promotes TGF-beta signaling in hepatic stellate cells via transcriptional and posttranscriptional regulation of TGF-beta receptors.
25145436 PDGFRs are genetically activated and are thus directly involved in stimulation of malignant cell growth. [Review]
25120810 No activating mutations of exons 12 and 18 in PDGFRA gene were found in patients with triple negative breast cancer
25033601 the frequency of detected cytogenetic aberrations MYC/MYCN, EGFR and PDGRFA, homozygous deletion of the CDKN2A gene, and deletion of the PTEN gene, pediatric glioblastomas bear analogy to the subgroup of IDH1-mutant glioblastomas in adults.
25025175 the proteins c-KIT, VEGFR2 and PDGFRalpha, encoded by genes at 4q12, are associated to the St Gallen breast cancer subgroup TNBC. No correlation was seen between high protein expression, increased gene copy number and BCM in the TNBC group.
25024074 Case Report: rectal gastrointestinal stromal tumor with kit and PDGFRA mutations.
24982425 miR-146b, PDGFRA, and GATA-1 formed a regulatory circuit to promote erythroid and megakaryocytic differentiation.
24945657 ACTA2, FSP1, and PDGFRa are unfavorable prognostic indicators of esophageal squamous cell carcinoma patients.
24934485 SNPs could be detected in exon 12 of the PDGFR-alpha gene in thyroid carcinoma showing thymus-like elements.
24837198 miR-34a could inhibit Akt [PKB (protein kinase B)] phosphorylation, which was restored by the overexpression of both PDGFR and MET.
24674454 Case Report: PDGFRA mutations in multiple sporadic gastrointestinal stromal tumors concomitant with ampullary adenocarcinoma.
24674052 PDGFRA mutations are associated with recurrence and metastasis in gastrointestinal stromal tumors.
24667490 Pdgfralpha expression is important in the fibrotic response to liver injury
24634380 Findings indicate platelet-derived growth factor receptor alpha (PDGFRalpha) as an attractive target for therapeutic development in uterine cancer.
24550449 A glioma classification scheme based on coexpression modules of EGFR and PDGFRA.
24489888 High levels of cell surface PDGFRA expression correlate with high tubulin expression in glioma tumor tissue in vivo.
24485751 We established a primary mechanism for PDGF mediated derivation and maintenance of hEGCs by demonstrating that OCT4 was upregulated and PTEN was suppressed in a dose dependent manner in response to PDGF
24458279 FP fusion gene favors secondary KIT mutations in MCs via growth and proliferation signals or that a yet unknown mechanism causes genomic instability with independent evolution of FP and KIT D816V
24369323 Review/Meta-analysis: imatinib resistance is closely associated with KIT and PDGFRA genotypes in gastrointestinal stromal tumors.
24266839 Rhabdoid gastrointestinal stromal tumours are associated with epithelioid morphology and PDGFRA mutations. The presence of additional genetic alterations in the rhabdoid areas indicates evolution from the epithelioid components.
24190966 Data indicate that mitochondrial reactive oxygen species (ROS) was required for persistent activation of PDGF receptor alpha (PDGFRalpha) in response to vitreous.
24157063 PDGFRA-mutated gastrointestinal stromal tumors (GISTs) display the same chromosomal aberrations as KIT-mutated GISTs
24151977 In the human gastrointestinal tract the telocytes are PDGFRalpha-positive.
24132921 Our study suggests that patients with melanoma harboring certain PDGFRA mutations may benefit from imatinib and crenolanib treatment.
24040448 A combination of histomorphology and PDGFRA immunostaining is a reliable predictor of PDGFRA genotype in gastrointestinal stromal tumors.
24022915 Perturbing the mesenchymal regulators, platelet-derived growth factor (PDGF) receptors or fibronectin, reverts mesenchymal stromal/stem cells (MSCs) toward mesodermal progenitors with endothelial potential.
23990986 Data indicate differential patterns of gene amplification and expression of receptor tyrosine kinases PDGFRA, KIT, and VEGFR2 at the 4q12 locus to be associated with specific phenotypes.
23970477 A distinct spectrum of mutations confers constitutive receptor activation and oncogenic activity to PDGFRalpha in childhood high-grade gliomas.
23928059 PDGFRalpha and IGF-1R are dynamically regulated and distributed in nucleus and cytoplasm in alveolar Rhabdomyosarcoma.
23914042 Case Report: FIP1L1/PDGFRA-negative cardiac eosinophilic infiltration promoting cardiac fibrosis, ventricular thickening, ventricular failure and thrombosis.
23833305 Our results indicate that fcDNA harboring tumor-specific mutations (CKIT andPDGFRA)- in the plasma of patients with gastrointestinal stromal tumor can be used as tumor-specific biomarker.
23776077 PDGFRalpha CD51 cells in fetal bone marrow represent a small subset of CD146 cells expressing Nestin and enriched for mesenchymal stem cell and hematopoietic stem cell niche activities.
23761726 The PDGFRA locus does not transfer a major risk of corneal astigmatism in people of Northern European ancestry.
23755839 Mutations of KIT or PDGFRA genes were identified in 78% of Korean children and young adults with gastrointestinal stromal tumors.
23752188 several newly identified PDGFRA mutations do not activate the receptor and may therefore represent passenger mutations
23696935 Case Report: urinary bladder urothelial carcinoma can show diverse differentiations into numerous histological types and variants, and can express KIT and PDGFRA.
23696920 Report PDGFRA expression in embryonic gut stem cells and suggest that gastrointestinal stromal tumor may arise from these cells.
23671131 miR-146a plays a key role in regulating the angiogenic activity of ECs in HCC through miR-146a-BRCA1-PDGFRA pathway.
23630597 A novel role for FGF2 in regulating PDGFRA expression in a subset of gliomas with younger age at disease onset and longer patient survival regardless of the morphological diagnosis.
23621836 despite expression of CD117 and PDGFRA, the absence of activating mutations in these tyrosine kinases makes KIT and PDGFRA unlikely candidates of MCC oncogenesis.
23621172 Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia.
23620752 The mRNA expressions of the proangiogenic growth factors VEGF, PDGF, bFGF and their receptors (VEGFR1, VEGFR2, PDGFRA, PDGFRB, FGFR1, FGFR2) were measured and compared in gastric ulcers of cirrhotic patients.
23618877 in human pulmonary fibroblasts, PDGF acts through IP3-induced Ca(2+)-release to trigger Ca(2+) waves, which in turn modulate gene expression of several matrix proteins.
23612575 Overall, 9 of the 34 patients with KIT/PDGFRA wild-type GIST carried mutations in one of the four subunits of the SDH complex (six patients in SDHA, two in SDHB, one in SDHC
23577108 PDGFR-alpha over-expression in SSc fibroblasts bound PDGF-AA more efficiently and promoted fibroblast transdifferentiation
23567961 Results identified dual FLT3/PDGFR inhibitors resulting from screening a library of 25,607 small molecules against the FLT3 dependent cell line MOLM-13 and the PDGFR dependent cell line EOL-1.
23438035 This study demonistrated that PDGFRA amplification is common in pediatric and adult high-grade astrocytoma.
23411580 Genetic analysis using PCR-direct sequencing method in paraffin sections identified no mutations of KIT and PDGFRA genes in 6 cases of small cell neuroendocrine carcinoma of the esophagus.
23401653 The variant exhibiting the strongest evidence for association with corneal curvature (rs6554163; p=2.8x10(-6)) is located in the same linkage disequilibrium block as the previously discovered PDGFRA variants.
23391309 These data suggest that a subfraction of the cardiac PDGFRalpha+ populations are progenitors contributing predominantly to the vascular and mesenchymal compartments of the human heart.
23292839 the author showed that, in cutaneous basal cell carcinoma, the expression of NCAM and c-KIT was high, PDGFRA was intermediate, and chromogranin A and synaptophysin was relatively low
23291969 Mutations in PDGFRA is associated with drug resistance in gastrointestinal stromal tumors.
23243022 Data indicate that the secreted glycoprotein stanniocalcin-1 (STC1) as a mediator of metastasis by PDGF receptor function in the setting of colorectal cancer.
23242283 Gain in PDGFRA is detected in 16.3% of diffuse astrocytomas, significantly more frequent than in oligodendrogliomas.
23171083 While KIT and PDGFRa mutations in foregut gastrointestinal stromal tumors were associated with negative and positive outcomes, respectively, this did not prove to be significant.
23146028 Four SNPs were identified, three in PDGFRalpha and one in PDGFRbeta.
23106360 An association between mutations KIT exon 9 p. 503-504_dup2, and PDGFRA exon 18 p. D842V and intestinal and gastric localization of tumors was found.
23074200 PDGFRA is altered through various genetic mechanisms in a subset of high-grade gliomas
23064464 inhibition of PDGFRA and PDGFRB in a patient with refractory late-stage NPM-ALK+ Anaplastic large cell lymphoma resulted in rapid, complete and sustained remission
22986233 study of 2 patients with well-differentiated fetal adenocarcinoma; expression of PDGFRalpha on the plasma membrane was demonstrated in the resected tumor specimens; reviewed potential role of PDGFRalpha in this disease
22969067 A significant role of the PDGFRA gene in determining corneal curvature in the Australian population was confirmed in this study.
22944561 description of polycythemia vera concurrent with FIP1L1-PDGFRA-positive myeloproliferative neoplasm with eosinophilia [case report]
22933705 Stromal PDGFRalpha inhibition represents a means for enhancing control of lung cancer growth in some cases, independent of tumor cell PDGFRalpha expression.
22744707 Platelet-derived growth factor receptor-alpha promotes lymphatic metastases in papillary thyroid cancer.
22718859 Some mutations, such as PDGFRA-D842V, seem to be clearly imatinib- and sunitinib-resistant in gastrointestinal stromal tumor patients.
22697462 We found a strong correlation of PDGFRalpha and PDGFRbeta expression on spindle-like cells and collagen deposition in systemic sclerosis biopsies indicating a strong link between PDGFR expression and fibrosis
22670177 PDGFRA mutations were absent in small cell lung carcinoma and protein expression did not provide prognostic information.
22661233 Study found that PDGFRalpha is expressed only in a subset of proneural glioblastoma , while PDGFRbeta is more commonly expressed in tumors but is preferentially expressed by self-renewing tumorigenic GBM stem cells.
22650155 PDGFRalpha identifies fibroblast-like cells (FLC) in human gastric smooth muscle. FLC were not altered in distribution or overall numbers in gastroparesis.
22593460 describe a gastric GIST harboring a novel PDGFRA exon 14 frameshift mutation caused by a single-nucleotide deletion
22558483 Case Report: primary small cell carcinoma of maxillary sinus immunohistochemically positive for KIT/PDGFRA with no mutations of either detected.
22543129 Over-expression of PDGFR-alpha on the surface of fibroblasts from systemic sclerosis lesions can bind more PDGF-AA ligands to increase cell proliferation and promote transdifferentiation to myofibroblasts.
22523564 results strongly suggest that JAK2 is activated by Fip1-like1 (FIP1L1)-platelet-derived growth factor receptor alpha (F/P) and is required for F/P stimulation of cellular proliferation and infiltration in chronic eosinophilic leukemia
22520943 Mutation in the PDGFRA inhibits adeno-associated virus type 5 transduction.
22473090 mutations in PDGFRa were identified in patients with cleft palate.
22449154 CD117 and PDGFRA staining are not exclusive, and the presence of a Golgi-like staining pattern for either, whilst not pathognomonic, is highly suggestive of KIT and PDGFRA mutated Gastrointestinal stromal tumors
22447844 Data show that the cyclin-dependent kinase 7/9 inhibitor (CDK7/9 inhibitor) potently inhibits FIP1L1-PDGFRalpha-positive Bcr-Abl-positive chronic myeloid leukemia (CML) cells.
22411791 Inhibition of endogenous FOXO proteins attenuated tetradecanoylphorbol Acetate/PDGF-BB mediated differentiation of neuroblastoma cells.
22399613 majority of gene mutations were identified in exon 11 of the KIT gene or exon 18 of the PDGFRA gene. The pattern of KIT and PDGFRA mutations in EGISTs was essentially similar to the one in GISTs
22394371 There is a 'small bowel' and a 'gastric' phenotype of inflammatory fibroid polyps which are associated with exon 12 and exon 18 PDGFRA mutations, respectively.
22389665 2 distinct subgroups of diffuse intrinsic pontine glioma (DIPG) were identified; one subgroup displayed oligodendroglial features, and appeared largely driven by PDGFRA, in particular through amplification and/or novel missense mutations in the extracellular domain
22327316 PDGFRA promoter SNPs (rs6554162 and rs1800812) may be associated with the risk of PTC.
22323597 PDGFRA-amplified Glioblastoma were found to have amplification of EGFR or the hepatocyte growth factor receptor gene (MET) as well.
22311673 two most commonly amplified receptor tyrosine kinase genes, EGFR and PDGFRA, were found to be present in variable proportions across the tumors, with one or the other gene predominating in certain areas of the same specimen.
22293178 Heparan sulfate sulfatase SULF2 regulates PDGFRalpha signaling and growth in human and mouse malignant glioma
22237707 Report protein expression and gene mutation status of PDGFRA in renal cell carcinoma.
22160160 High expression of PDGFRA was significantly correlated with shorter patient survival and could serve as a prognostic marker.
22144915 This highlights the potential role of variants in PDGFRA in the genetic etiology of corneal astigmatism across diverse Asian populations [meta-analysis]
22137795 multiple receptor tyrosine kinases are amplified in a subset of glioblastoma subclones, epidermal growth factor receptor, MET and platelet-derived growth factor receptor alpha
22080864 PDGFRalpha signaling in glioblastomas leads to Src-dependent phosphorylation of the guanine nucleotide exchange factor Dock180 at tyrosine 1811 (Dock180(Y1811)) that results in activation of the GTPase Rac1 and subsequent cell growth and invasion.
22076173 Case Report: rare case of esophageal small cell carcinoma with KIT and PDGFRA expressions but without KIT and PDGFRA mutations.
21993628 human PDGFR-alpha activation in mouse beta-cells stimulated Erk1/2 phosphorylation, leading to Ezh2-dependent expansion of adult beta-cells
21953054 These data suggest that KIT and PDGFRA mutations and standardized mitotic count deserve to be investigated to evaluate the relapse risk of Gastrointestinal stromal tumors
21947029 CD9(+)/CD140a(+) cells may constitute an even more highly enriched population of myelinogenic progenitor cells.
21819482 the F-P fusion gene was not detected with increased frequency in EoE.
21818111 Treatment with imatinib is associated with an excellent prognosis in FIP1L1-PDGFRA-positive chronic eosinophilic leukemia in first chronic phase
21769672 Studies suggest that various isoforms of PDGF bind with differential affinities to two related tyrosine kinase receptors, denoted the PDGF alpha- and beta-receptors.
21725412 In one tumour, c-Kit mutation analysis demonstrated positivity of exon 11_c.1674_1676delGGT, thus confirming the diagnosis of a GIST. Mutational analysis of the second stomach lesion demonstrated negativity for all known c-KIT and PDGFRA exons.
21665993 Polymorphisms of FRAP1 and PDGFRA were associated with corneal curvature in Asian populations.
21645144 PDGF and PDGFR-alpha may be involved in the pathophysiology of the human thymus.
21642621 Even though retinal pigment epithelial cells express less PDGFRalpha than fibroblasts, it boosts proliferative vitreoretinopathy-related signaling events and cellular responses of ARPE19 cells.
21605429 The aim of this paper is to review the clinical significance of tyrosine kinase mutational status of KIT or PDGFRA genes.
21596750 specific inhibition of Cbl interaction with RTKs promotes the osteogenic differentiation program in hMSCs in part by decreased Cbl-mediated PDGFRalpha and FGFR2 ubiquitination
21590454 High PDGFRA is associated with recurrence in hepatocellular carcinoma.
21574155 this study demonstrated that coexpression of PDGFR-alpha, PDGFR-beta and VEGF is an independent prognostic factor for predicting early tumor recurrence and poor prognosis in hepatocellular carcinoma.
21527588 KIT/PDGFRA mutations are very frequent molecular event in GISTs and the type of mutation has a prognostic significance for patients' outcome.
21496277 In addition to c-Met, the cross-talk with Axl and/or PDGFR-alpha also contributes to the progression of human bladder cancer
21478825 KIT and PDGFRA mutations do occur in ocular melanomas at a frequency (11%) that is similar to acral and mucosal melanomas
21461555 Data confirm that the type of KIT mutation is associated with various clinicopathologic features of gastrointestinal stromal tumors, and indicate that PDGFRA mutations are associated with rather indolent tumors.
21434524 The high rate of c-Kit/PDGFRA coexpression suggests that both receptors are involved in oncogenicity in gastrointestinal stromal tumors
21403518 mutational status of PDGFRA gene in ipsilateral testicular seminomas
21399396 FIP1L1/PDGFRA fusion gene-positive myeloproliferative disorders with eosinophilia are discussed.
21397860 Data show that induction of PDGFRalpha and invadopodia is essential for Twist1 to promote tumor metastasis.
21396851 High expression of PDGFR-alpha is associated with poor response to sorafenib in metastatic renal cell carcinoma.
21387320 Mutational status of PDGFRA are not associated with primary gastrointestinal stromal tumors.
21382095 amplification of PDGFRA, KIT and KDR may be implicated in the pathogenesis of a small fraction of both subtypes of glioblastoma
21357737 Chronically activated, monomeric PDGFRA induced prolonged activation of Akt and suppressed the level of p53.
21310211 The Lnk is a negative regulator of PDGFRalpha signaling.
21281241 Acquired PDGFRA mutation has resulted in decreased imatinib sensitivity in chronic eosinophilic leukemia with T-cell clonal evolution.
21274753 PDGFR-alpha mutation in EGISTs was essentially similar to that in GISTs
21224473 our data provide evidence that imatinib-sensitive PDGFRA point mutations play an important role in the pathogenesis of hypereosinophilic syndrome
21210262 We found that hedgehog-interacting protein, PDGFRalpha, smoothened and Su(Fu) gene highly expressed in the primary esophageal squamous cell carcinomas
21157293 Expression of PDGFR in the formalin-fixed vestibular schwannoma tumor tissue was observed in 23 (67.5%) of the 34 samples.
21131919 Primary esophageal melanomas of Caucasian patients did not harbor mutations of PDGFRA.
21092857 PDGFalphaR transgenic mice provide an effective means to determine the fate of NG2-positive cells in vivo under both normal and pathological conditions.
21080877 PDGFRA expression is not a prognostic marker for osteosarcoma patients
20889717 PDGFRA mutants behave as oncogenes in this subset of gliomas
20861712 Small gastrointestinal stromal tumors (GISTs) share with overt GIST KIT/PDGFRA mutation.
20823768 C-KIT and PDGFRA zygosity in gastrointestinal stromal tumors: Correlation with tumor site, tumor size, exon, and CD117 immunohistochemistry.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20718716 PDGFRA mutations cn be found in gastrointestinal stromal tumors.
20686603 Transcript and protein expression of PDGFRA matched well with its increased copy number suggesting a central role of PDGFRA within the amplicon in malignant peripheral nerve sheath tumors.
20651400 Prognostic relevance of KIT and PDGFRA mutations in gastrointestinal stromal tumors.
20651400 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20615084 PDGFRA alternative transcripts resulting in PDGFRA gene fusions are associated with aematological malignancies and eosinophilia.
20598160 Standard operating procedures were developed to identify potential pitfalls when performing PDGFRA mutational analysis in gastrointestinal stromal tumors.
20589679 High PDGFRalpha and phosphorylation is associated with recurrent glioblastoma.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20479398 Single nucleotide polymorphism in PDGFRalpha is associated with pediatric high-grade gliomas.
20473908 PDGFRA mutations are associated with sensitivity to Imatinib in gastrointestinal stromal tumors.
20470368 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20442296 PDGFRalpha mutant lacking the extracellular ligand-binding domain is associated with bone-metastatic potential to prostate cancer.
20425130 PDGFRA gene mutations were not found in a Japanese melanoma population.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20393746 Six Vanek's tumors harbored activating mutations in PDGFRA exons 12 (n = 5) and 18 (n = 1) respectively: S566_E571delinsK (n = 1), S566_E571delinsR (n = 4), and D842 del (n = 1).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20169295 PDGFRA mutations are linked with familial vitiligo vulgaris in a Chinese population.
20169295 Observational study of gene-disease association. (HuGE Navigator)
20133985 There was no mutational correlation between GISTs and the coexistent tumors of different histogenesis regarding KIT and PDGFRA genes.
20129251 Aberrations and gene expression of EGFR, NF1, and PDGFRA/IDH1 each define the Classical, Mesenchymal, and Proneural subtypes, respectively of glioblastoma multiforme
20107158 Clinically significant overexpression of PDGFRalpha is detected in eosinophilia-associated myeloproliferative neoplasm disorders, as a possible indicator of underlying fusion.
20071345 these data from human genetics and animal models support a role for PDGF-signaling in normal PV development, and in the pathogenesis of TAPVR.
20036812 Studies indicate communication between tumor cells and their microenvironment is through polypeptide growth factors EGF, FGF, PDGF and receptors for these growth factors.
20023271 DHPLC is a cost-effective, rapid, and sensitive test for screening for mutations of c-KIT and PDGFRA in GISTs.
20023271 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
20001342 Genetic changes of therapeutically relevant exons of the PDGFRA gene and the c-kit gene are not seen in giant cell tumours of bone.
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19943934 Fifteen and eleven gastrointestinal stromal tumours tumours possessed mutations in KIT and PDGFRA, respectively
19936766 VEGFR1, VEGFR2, and PDGFRalpha are over-expressed in K-ras mutated colorectal adenocarcinoma.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19900103 PDGFRA-mutated GISTs have distinctive histological patterns that are differentiated from KIT-mutated GISTs.
19900103 Observational study of gene-disease association. (HuGE Navigator)
19862822 PDGFRA may be amplified in fibrosarcoma of bone.
19861461 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19846951 study found all the subtypes of thymomas and the thymic carcinomas showed staining for PDGFRA, but no mutations in the known mutational hotspots were identified
19843560 for the in situ PLA reaction a PDGFRbeta-specific antibody was used
19839721 PDGF receptor signaling sustains proliferation without affecting osteogenic differentiation of mesenchymal stem cells.
19787330 Of the tumors 85% carry somatic activating mutations in the receptor tyrosine kinases KIT or PDGFRA. The detection of these molecular events has changed the treatment.
19779861 KIT, PDGFRA, and VEGFR2 amplifications were all present in 4% of Medulloblastomas and primitive neuroectodermal tumor and KIT amplification was associated with concurrent PDGFRA and VEGFR2 amplifications
19756614 The majority of IFP reveal activating PDGFRA mutations. Our data indicate that IFP are true neoplasms (true benign tumors) and not reactive lesions.
19755855 Observations implicate PDGFRA and KIT as potential oncogenes in NSCLC.
19717644 The proportion of phosphorylated PDGF receptor alpha was low in choroid plexus papillomas and choroid plexus carcinomas, whereas phosphorylated PDGF receptor beta was found to be significantly higher in choroid plexus carcinomas.
19707201 concurrent expression of PDGFA and PDGFRA in different subtypes of gliomas, reinforce the recognised significance of this signalling pathway in gliomas.
19696981 Analysis of the hot spot regions of KIT and PDGFRalpha genes is important for therapy planning and also may have some prognostic significance, for which reason it is recommended to be performed in GIST regularly.
19694830 Expression and mutational analysis of PDGFRA in renal cell carcinoma is reported.
19675092 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19649203 PDGF-Ralpha strongly impairs melanoma growth
19648886 Observational study of gene-disease association. (HuGE Navigator)
19644140 Data show that chimeric receptor tyrosine kinases escape ubiquitination and down-regulation and that their stabilization is critical to efficient stimulation of cell proliferation.
19614767 In the absence of RAS mutations, MAPK could be activated through SCF/KIT autocrine/paracrine mechanisms and/or mutated BRAF in a subset of KIT/PDGFRA wild-type GISTs.
19563658 analysis of the experssion of EGFR, PDGFRA and VEGFR2 in cervical adenosquamous carcinoma
19563658 Observational study of gene-disease association. (HuGE Navigator)
19496203 Results provide the first report of esophageal malignant melanoma with an examination of the expression of KIT and PDGFRA and the mutational status of KIT and PDGFRA genes.
19448595 This study showed consistent expression and common mutational activation of PDGFRA in small intestinal inflammatory fibroid polyps
19411681 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19393245 residues that compose the target motif of the PDGFRA form part of the alpha 3 helix of p190-A.
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19335066 PDGFRA is involved in tumor angiogenesis & maintenance of the tumor microenvironment & is implicated in development & metastasis of HCC, as well as playing a role in normal angiogenesis and embryo development. Review.
19333949 Purified IgG samples from patients with systemic sclerosis were positive when tested for antinuclear autoantibodies, but did not specifically activate PDGFRalpha or PDGFRbeta in any of the tests
19333919 one-third of sera from scleroderma patients contained detectable autoantibodies to PDGFR, but these antibodies were not specific to scleroderma
19333543 results suggest interstitial cells of Cajal adjacent to overt gastrointestinal stromal tumors (GISTs) did not have mutations in c-kit or PDGFRA genes; overt GISTs may develop after local & sporadic acquisition of these mutations with additional events
19326424 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19307738 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19302534 expression of c-kit, PDGFR-alpha and -beta is a common feature of KS, regardless of stage and clinical settings.
19291337 The authors conclude that KIT exon 11 deletions and somatic loss of the wild-type KIT identified post-surgical gastrointestinal stromal tumor patients with poor prognosis.
19291337 Observational study of gene-disease association. (HuGE Navigator)
19248967 REVIEW: role of c-kit and PDGFRA mutations in gastrointestinal stromal tumor
19215021 Results suggest that the child's PDGFRA promoter haplotype is differentially sensitive for periconceptional exposure to glucose, myo-inositol, and zinc in the risk of spina bifida.
19215021 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19212337 FIP1L1-PDGFRalpha D842V mutation is associated with drug resistance in chronic eosinophilic leukemia.
19126548 a novel mechanism for activation of PDGFRalpha that appears capable of enhancing the responsiveness of cells to growth factors outside of the PDGF family.
19118897 studied a new FISH method to detect CHIC2 deletion, FIP1L1/PDGFRA fusion and PDGFRA translocation in patients with myeloid neoplasms associated with eosinophilia
19115205 combined inhibition of PDGFRalpha and -beta results in markedly decreased tumor growth in vivo because of impaired recruitment of periendothelial cells.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19047372 PDGFRalpha signaling stimulates osteogenesis of neural crest cells-derived osteoblasts by activating the PLC-gamma pathway, suggesting an involvement of this pathway in the etiology of human craniosynostosis.
19035305 data showed that no pathogenic mutations in PDGFRA and PDGFRB were detected in the context of core-binding factor leukaemia (CBFL) without KIT and FLT3 mutations; thus, PDGFR genes do not seem to be involved in CBFL
18992915 We showed that Prx I, PDGF-A, and PDGFR-alpha follow the same expression pattern during carcinoma ex pleomorphic adenoma progression.
18987651 characterized FIP1L1-PDGFRA junction sequences from 113 patients at the mRNA (n=113) and genomic DNA (n=85) levels
18978678 Observational study of gene-disease association. (HuGE Navigator)
18955458 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18950958 VEGF, HIF-1alpha, and predominantly PDGFRalpha are expressed in neoplastic cells in the majority of Hodgkin lymphomas.
18758297 High tumor cell PDGFR-alpha is associated with non-small cell lung cancer.
18706197 FIP1L1-PDGFRalpha emerges as a relatively homogeneous clinicobiological entity that co-exists with other abnormalities of tyrosine kinase family genes. It reflects the disease progression and there is a good response to imatinib.
18701889 data indicate that PDGFR-alpha is a critical receptor required for HCMV infection, and thus a target for novel anti-viral therapies
18686281 the vast majority of IFPs harbour gain-of-function mutations in the PDGFRA gene. The presence of PDGFRA mutations questions the reactive nature of IFPs and raises the possibility of a neoplastic process.
18679424 Proof-of-principal for PDGFR-A as a therapeutic target in alveolar rhabdomyosarcoma.
18636362 Most gastrointestinal stromal tumors have a c-kit or PDGFRA gene mutation.
18633616 Overall survival in mature T- and NK-cell lymphomas correlated with disease subtypes and prognostic index but not PDGFRA (platelet-derived growth factor receptor alpha) expression. PDGFRA expression was different in mature T- and NK-cell lymphomas
18618605 Observational study of gene-disease association. (HuGE Navigator)
18615679 Observational study of gene-disease association. (HuGE Navigator)
18548106 constitutively active PDGFRA mutation found in acute lymphoblastic leukemia that may be associated with leukemic cell growth
18547963 PDGFRalpha mutations in GISTs were found to be rare in this Korean population
18519768 high expression of p-PDGFR alpha and PDGFR beta was the only significant association with malignant histology in childhood glioma
18492696 There is significant expression of PDGFR-beta in ovarian granulosa cell tumors, whereas normal ovarian tissues have a complete absence of staining.
18464291 PDGFRA promoter haplotypes may predispose to gliomas
18464291 Observational study of gene-disease association. (HuGE Navigator)
18416137 Significant correlation between PDGFRA mutations, on the one hand, and tumor site and histological pattern of GastroIntestinal Stromal Tumors (GIST), on the other.
18360281 When critically applied, CD117/PDGFRA immunophenotyping is a useful diagnostic tool correctly predicting the presence of PDGFRA mutations in most cases.
18331602 demonstrated the expression of PDGFalpha and PDGFbeta in the peripheral blood samples of transient myeloproliferative disorder, indicating that the PDGF pathway may play an important role in the fibrosis of several organs in patients with TMD
18326546 The proteins and mRNA transcripts for PDGFRA were detected in oocytes. PDGFR-alpha mRNA was expressed in granulosa cells of a minority of the samples from women/girls.
18314611 may be mutated in gastrointtestinal stromal tumors.
18312355 PDGFRA genotyping is important for gastrointestinal stromal tumours diagnosis and assessment of sensitivity to tyrosine kinase inhibitors.(Review)
18288404 PDGFRalpha expression in colorectal cancer significantly correlated with lymph node metastasis.
18284546 regularly expressed in variable levels in ameloblastomas, and somatic mutations of exon 12 and exon 18 are rare findings
18265649 As a sensitive and specific marker of GIST, PDGFR-alpha oncogenic mutations are more likely seen in giant, CD-117-negative GISTs arising outside the gastrointestinal tract and have an unfavorable clinical course.
18197502 Phosphorylated protein induced by PDGFR-alpha mutation may be associated with the important alternative molecular mechanism and the biological behavior of gastrointestinal and extra-gastrointestinal stromal tumor development.
18190445 Three out of nine (33.3%) Merkel cell carcinomas showed an identical novel single heterozygous base change in exon 10 of the PDGFRA gene
18187489 Observational study of gene-disease association. (HuGE Navigator)
18157090 Expression status of PDGF receptor alpha was not significantly associated with progression-free survival in choroid plexus carcinomas.
18084259 Silent mutations of KIT and PDGFRA were found in Merkel cell carcinoma that have the potential to lead to alternate protein function.
18077793 PDGFR-alpha receptors contribute to the formation of the renal cortical interstitium
18070887 Phosphatidylinositol 3-kinase-dependent membrane recruitment of Rac-1 and p47phox is critical for alpha-platelet-derived growth factor receptor-induced production of reactive oxygen species.
18042065 one mixed cell-type GIST showed a somatic PDGFRalpha mutation...both epithelioid and spindle components showed identical mutations
17881156 Transcriptional regulation of PDGFRA by E2F1.
17827398 The incidence of both KIT and PDGFRA mutations in a Portuguese series was 63%. The great majority of mutations were located in KIT exon 11, statistically associated with worse prognosis and indicative of favourable response to imatinib-based therapy.
17762857 PDGFRA is not the relavant gene in melanoma that drives the selection of copy number increases of the locus
17701174 A new fusion transcript skiping alphaPDGFR exon 12 forms by a previously unreported splicing mechanism. Exon skipping did not disrupt exonic splicing enhancers within the exon but lost most of FIP1L intron 8a (intronic splicing enhancers).
17690840 A positive correlation was observed between PDGFR-alpha and proliferation index in pilocytic astrocytomas; expression of PDGFR-alpha was significantly related to progression-free survival.
17673922 A significant correlation was found between a higher protein expression of PDGFRA and longer disease-free survival of patients with gastrointestinal stromal tumors of stomach and intestine.
17623951 No associations were found with exons 12 and 18 of the PDGFRA gene and GIST.
17591942 Fluorescence in situ hybridization and reverse transcriptase-polymerase chain reaction protocols were developed for an accurate del(4)(q12q12) and FIP1L1-PDGFRA fusion gene detection.
17568391 sequence variation in diaphragmatic hernia
17566086 Multiple gastrointestinal stromal and other tumors may be caused by germline PDGFRA gene mutations (V561D.
17532173 GISTs were commonly associated with KIT mutation, but rarely associated with PDGFRA mutation in Taiwan.
17532173 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17448020 PDGFRalpha was expressed in 24/37 endometrial stromal sarcomas(ESS)[65%; strongly by 19/37 & weakly by 5/37 ESS]; mutational analysis of PDGFRalpha & PDGFRbeta of metastatic ESS from 3 patients detected no mutations leading to amino acid changes
17438095 Genomic alterations were present at disease onset in 1/3 of the examined cases. They therefore represent an early event possibly related to primary imatinib resistance in gastrointestinal stromal tumors.
17377585 FIP1L1-PDGFRA-positive patients who presented with acute myeloid leukemia (AML, n=5) or lymphoblastic T-cell non-Hodgkin-lymphoma (n=2) in conjunction with AML or Eos-MPD.
17363728 Stimulatory antibodies to PDGFR-A&-B were found selectively in all patients with extensive cGVHD but in none of the patients without cGVHD. Higher levels were detected in patients with generalized skin involvement and/or lung fibrosis.
17344284 these observations indicate that an IE and/or E human cytomegalovirus protein(s) downregulates the expression of PDGFR-alpha and -beta in smooth muscle cells
17299092 FIP1L1 and PDGFRalpha have roles in response to imatinib mesylate in chronic eosinophilic leukemia
17298867 no activating mutations in the PDGFRA were found, but pleomorphism was identified in exon 18 of the PDGFRA gene in children with Ewing sarcoma
17261495 data and previous reports suggest that FIP1L1-PDGFRA - positive HES is a distinct clinical entity with myeloproliferative features and showing a poor response to corticosteroid treatment
17214097 These cases demonstrate the first known linkage between F1P1L1-PDGFRalpha and hypereosinophilic syndrome
17193822 PDGFRA mutations usually occur in gastric GISTs, especially in the epithelioid variants; their overall frequency is approximately 30% to 40% of KIT mutation negative GISTs. Most common is exon 18 mutation leading Asp842Val at the protein level.
17145809 The PDGFRA was less expressed and phosphorylated with the absence of gain-of-function mutations and the presence of the cognate ligands, strongly support the hypothesis that the activation mechanism is the autocrine/paracrine loop in chordoma.
17137731 The presence of the FIP1L1-PDGFRA fusion gene is detected in chronic eosinophilic leukemia.
17079230 17-AAG promotes PDGFRalpha degradation selectively in transformed cells
17070723 Signaling through PDGFRA activates RhoA, which results in Rho-associated kinase-dependent cofilin phosphorylation, enhancing smooth muscle alpha-actin filament polymerization, and upregulates smooth muscle alpha-actin expression.
17047316 In midgut carcinoid tumor stroma PDGFRalpha was expressed in 35%, PDGFRbeta in 94% and EGFR in 9%.
16892550 PDGFRalpha mutations have been identified as alternative oncogenic mechanism in gastrointestinal stromal tumors.
16850112 77% of the examined primary central nervous system lymphoma specimens showed expression of PDGFRalpha. Tumours expressing survivin frequently co-expressed PDGFRalpha.
16804324 Observational study of gene-disease association. (HuGE Navigator)
16785193 Gastrointestinal stromal tumours (GIST) with platelet-derived growth factor receptor mutations often have reduced expression of the KIT protein in immunohistochemistry (IHC), suggesting that IHC may be potentially useful in identification of such GISTs.
16730575 Observational study of gene-disease association. (HuGE Navigator)
16697720 Observational study of gene-disease association. (HuGE Navigator)
16690743 FIP1L1-PDGFRalpha activation requires disruption of the juxtamembrane domain of PDGFRalpha and is FIP1L1-independent
16685437 Six of the 20 gastrointestinal stomach tumors lacking KIT mutations had mutations in exon 18 of PDGFRA, and 1 had a mutation in exon 12 in this receptor.
16675559 The most intense expression of PDGFRalpha was observed in fibroblasts in the lung carcinoma outer rim.
16502585 Fusion protein is detected in hypereosinophilic syndrome and chronic eosinophilic leukemia.
16498388 Demonstrates the utility of screening for PDGFRA kinase domain overexpression in patients with IHES and has identified KIF5B as a third PDGFRA fusion partner in chronic myeloproliferative disorders.
16373964 activating mutations of PDGFR-alpha, c-kit and B-RAF are absent in gliosarcomas
16357008 describes frequence mutation of PDGFRA in malignant periphaerl nerve sheath tumors often associated with coamplification of KIT
16331269 Specific PDGFR inhibition by siRNA or a neutralizing antibody to the receptor inhibited PDGF-stimulated receptor activation and cell proliferation, suggesting that receptor targeting has a role in ovarian cancer treatment
16305343 data describe percentage of bone marrow cells expressing receptors for interleukin-1, platelet-derived growth factor, fibroblast growth factor, transforming growth factor-beta, epidermal growth factor and c-Fos and c-Myc in untreated lung & breast cancer
16283668 Observational study of gene-disease association. (HuGE Navigator)
16283668 PDGFRA P1 promoter region haplotypes do not have a major role in the development of spina bifida meningomyelocele .
16186508 Two-basepair deletion in the C terminus of PDGFRA (exon 23) found in glioblastomas.
16168125 An intronic insertion IVS17-50insA at exon 18 in all sequenced cases. None of these genetic alterations was correlated with PDGFR-alpha expression in breast cancer.
16135486 Observational study of gene-disease association. (HuGE Navigator)
16126374 The current identification of cis-acting elements in the PDGFRA promoter and the transcription factors that bind them, provides a new strategy for the identification of genes that are potentially involved in neural tube defects.
16116920 The hypereosinophilic syndrome may result from a novel fusion tyrosine kinase - FIP1L1-PDGFRalpha - that is a consequence of an interstitial chromosomal deletion.
15928335 PDGFRA mutations are associated with gastrointestinal stromal tumors
15897742 The point mutations of c-kit and platelet- derived growth factor receptor alpha genes may play a limited role in the tumorigenesis of type 1 neurofibromatosis-associated gastrointestinal stromal tumors.
15894928 single example of Gastrointestinal Stromal Tumor with activating mutation and immunoreactivity without CD117 positivity
15871904 In human ASMCs, IFNgamma again stimulated a transient STAT1-binding to the PDGF-Ralpha promoter.
15862965 Western blot showed a high amount of PDGFRalpha and beta proteins in primary stromal cells that could not be detected in prostatic cancer cells.
15791568 study demonstrates that platelet-derived growth factor receptor alpha and beta, and c-kit protein are expressed in a high percentage of epithelial ovarian cancers
15685537 High sensitivity of the imatinib-resistant KIT -T670I and KIT -V654A and of PDGFRA -D842V mutants to PKC412 in gastrointestinal stromal tumors.
15674355 The Receptor, PDGF alpha (PDGFRA)is implicated in the pathogenesis of AML, and the mechanisms of cytogenetic progression and oncoprotein-driven function may be similar in AML expressing oncogenic forms of PDGFRA.
15635072 link between single nucleotide polymorphisms (SNPs) within the PDGFRalpha gene promoter and the occurrence of brain tumours
15492989 These results suggest that myxoid epithelioid GISTs are a distinct subtype of GISTs that are closely correlated with the PDGFRA gene mutation
15380338 Observational study of gene-disease association. (HuGE Navigator)
15326474 gene expression profiling of 26 gastrointesstinsal stromsal tumors with known KIT and PDGFRA mutational status
15284118 FIP1L1-PDGFRA is a relatively infrequent but treatment-relevant mutation in primary eosinophilia that is indicative of an underlying systemic mastocytosis.
15154005 PDGFRA mutations were found in 7 (25.0%)gastrointestinal stromal tumors (GISTs) , carrying either D842 V mutations or exon 18 deletions.
14766209 PDGFRa expression is regulated by C-EBP
14745431 results confirm the high frequency of BCR-ABL kinase domain mutations in patients with secondary resistance to imatinib and exclude mutations of the activation loops of KIT, PDGFRA and PDGFRB as causes of resistance in patients without ABL mutations
14741194 Result from our case-control study demonstrated that the frequencies of haplotypes with low transcription activity were significantly higher in NTD mothers than that observed in control mothers (odds ratio=2.2, 95% CI=1.0-4.6).
14630792 results indicate that the fusion of FIP1L1 to PDGFRA occurs rarely in leukemia cell lines
12842979 observations suggest that the FIP1L1-PDGFRA rearrangement occurs in an early hematopoietic progenitor and suggests that the molecular pathogenesis for a subset of SMCD patients is similar to that of HES
12660384 The hypereosinophilic syndrome may result from a novel fusion tyrosine kinase - FIP1L1-PDGFRalpha - that is a consequence of an interstitial chromosomal deletion.
12522257 KIT and PDGFRA mutations appear to be alternative and mutually exclusive oncogenic mechanisms in gastrointestinal stromal tumors
12176024 PDGFRA is endogenenously activated in medulloblastoma tumor cell lines
12023424 high expression associated with long survival in patients with grade 2 astrocytomas and oligoastrocytomas
11175793 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVE      1 - 70
IRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIV     71 - 140
EDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKA    141 - 210
TSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEA    211 - 280
TVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWL    281 - 350
KNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDL    351 - 420
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTF    421 - 490
AKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWR    491 - 560
VIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLK    561 - 630
PTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEK    631 - 700
PKKELDIFGLNPADESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKK    701 - 770
KSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA    771 - 840
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIK    841 - 910
SGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARM    911 - 980
RVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAI    981 - 1050
ETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL                                  1051 - 1089
//

Text Mined References (412)

PMID Year Title
26867653 2016 Parallelism of DOG1 expression with recurrence risk in gastrointestinal stromal tumors bearing KIT or PDGFRA mutations.
26772734 2016 Correlation of KIT and PDGFRA mutational status with clinical benefit in patients with gastrointestinal stromal tumor treated with sunitinib in a worldwide treatment-use trial.
26544626 2015 Molecular characterization of metastatic exon 11 mutant gastrointestinal stromal tumors (GIST) beyond KIT/PDGFR? genotype evaluated by next generation sequencing (NGS).
26297547 2015 miR-140-5p inhibits ovarian cancer growth partially by repression of PDGFRA.
26284551 2015 Platelet-Derived Growth Factor-BB Enhances Adipogenesis in Orbital Fibroblasts.
26191304 2015 Myxoid epithelioid gastrointestinal stromal tumor harboring an unreported PDGFRA mutation: report of a case and review of the literature.
26191303 2015 Therapy-related acute myeloid leukemia with eosinophilia, basophilia, t(4;14)(q12;q24) and PDGFRA rearrangement: a case report and review of the literature.
26191287 2015 Presence of PDGFRA and DOG1 mutations in gastrointestinal stromal tumors among Chinese population.
26189259 2015 Cervical squamous cancer mRNA profiles reveal the key genes of metastasis and invasion.
25970686 2015 KIT, PDGFRA, and BRAF mutational spectrum impacts on the natural history of imatinib-naive localized GIST: a population-based study.
25936870 2015 Correlation of Merkel cell polyomavirus positivity with PDGFR? mutations and survivin expression in Merkel cell carcinoma.
25880691 2015 Constitutive activation of oncogenic PDGFR?-mutant proteins occurring in GIST patients induces receptor mislocalisation and alters PDGFR? signalling characteristics.
25748235 2015 Exome sequencing of bilateral testicular germ cell tumors suggests independent development lineages.
25744030 2015 Platelet-derived growth factor receptors form complexes with neuropilin-1 during megakaryocytic differentiation of thrombopoietin-dependent UT-7/TPO cells.
25700367 2015 PDGFR? in liver pathophysiology: emerging roles in development, regeneration, fibrosis, and cancer.
25674291 2014 Synchronous poorly-differentiated neuroendocrine carcinoma and gastrointestinal stromal tumor of the stomach: a case report with immunohistochemical and molecular genetic analyses of KIT and PDGFRA.
25659388 2015 Mutational profile of KIT and PDGFRA genes in gastrointestinal stromal tumors in Peruvian samples.
25621775 2015 [The importance of mutational status in prognosis and therapy of GIST].
25605837 2015 KIT and PDGFRA mutations and the risk of GI stromal tumor recurrence.
25502837 2015 PDGFR? and ? play critical roles in mediating Foxq1-driven breast cancer stemness and chemoresistance.
25481675 2015 Molecular spectrum of c-KIT and PDGFRA gene mutations in gastro intestinal stromal tumor: determination of frequency, distribution pattern and identification of novel mutations in Indian patients.
25425645 2015 The DNA replication licensing factor miniature chromosome maintenance 7 is essential for RNA splicing of epidermal growth factor receptor, c-Met, and platelet-derived growth factor receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25411163 2015 Identification of a variant in KDR associated with serum VEGFR2 and pharmacodynamics of Pazopanib.
25380967 2014 PDGF receptor alpha inhibition induces apoptosis in glioblastoma cancer stem cells refractory to anti-Notch and anti-EGFR treatment.
25333264 2014 Overexpression of platelet-derived growth factor receptor alpha promotes tumor progression and indicates poor prognosis in hepatocellular carcinoma.
25323095 2015 Immunohistochemical expression of receptor tyrosine kinase PDGFR-?, c-Met, and EGFR in skull base chordoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25202099 2014 Sorafenib efficacy in thymic carcinomas seems not to require c-KIT or PDGFR-alpha mutations.
25169976 2014 PDGF receptor-? promotes TGF-? signaling in hepatic stellate cells via transcriptional and posttranscriptional regulation of TGF-? receptors.
25145436 2014 PDGF receptors in tumor biology: prognostic and predictive potential.
25120810 2014 C-kit and PDGFRA gene mutations in triple negative breast cancer.
25033601 2014 [Comparative characteristics of genetic aberrations in glioblastomas in children and adults].
25025175 2014 The three receptor tyrosine kinases c-KIT, VEGFR2 and PDGFR?, closely spaced at 4q12, show increased protein expression in triple-negative breast cancer.
25024074 2016 Case of Rectal GI Stromal Tumor Demonstrating that KIT and PDGFRA Mutations Are Not Always Mutually Exclusive.
24982425 2014 The regulatory roles of microRNA-146b-5p and its target platelet-derived growth factor receptor ? (PDGFRA) in erythropoiesis and megakaryocytopoiesis.
24963161 2014 CMPK1 and RBP3 are associated with corneal curvature in Asian populations.
24945657 2014 The prognostic significance of cancer-associated fibroblasts in esophageal squamous cell carcinoma.
24934485 2014 KRAS, EGFR, PDGFR-?, KIT and COX-2 status in carcinoma showing thymus-like elements (CASTLE).
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24837198 2014 MicroRNA-34A inhibits the growth, invasion and metastasis of gastric cancer by targeting PDGFR and MET expression.
24674454 2014 Multiple sporadic gastrointestinal stromal tumors concomitant with ampullary adenocarcinoma: a case report with KIT and PDGFRA mutational analysis and miR-221/222 expression profile.
24674052 2014 Prognostic value of KIT/PDGFRA mutations in gastrointestinal stromal tumors: a meta-analysis.
24667490 2014 Activation of platelet-derived growth factor receptor alpha contributes to liver fibrosis.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24634380 2014 Biologic effects of platelet-derived growth factor receptor ? blockade in uterine cancer.
24550449 2014 A glioma classification scheme based on coexpression modules of EGFR and PDGFRA.
24489888 2014 Glioma cell proliferation controlled by ERK activity-dependent surface expression of PDGFRA.
24485751 PDGF mediates derivation of human embryonic germ cells.
24458279 2014 The FIP1L1-PDGFRA fusion gene and the KIT D816V mutation are coexisting in a small subset of myeloid/lymphoid neoplasms with eosinophilia.
24369323 2013 Correlation of imatinib resistance with the mutational status of KIT and PDGFRA genes in gastrointestinal stromal tumors: a meta-analysis.
24266839 2014 Rhabdoid morphology in gastrointestinal stromal tumours (GISTs) is associated with PDGFRA mutations but does not imply aggressive behaviour.
24190966 2014 A reactive oxygen species-mediated, self-perpetuating loop persistently activates platelet-derived growth factor receptor ?.
24157063 2014 Chromosomal aberrations in primary PDGFRA-mutated gastrointestinal stromal tumors.
24151977 2013 Telocytes express PDGFR? in the human gastrointestinal tract.
24132921 2013 Large-scale analysis of PDGFRA mutations in melanomas and evaluation of their sensitivity to tyrosine kinase inhibitors imatinib and crenolanib.
24040448 2013 Value of epithelioid morphology and PDGFRA immunostaining pattern for prediction of PDGFRA mutated genotype in gastrointestinal stromal tumors (GISTs).
24022915 2014 Mesenchymal stromal cells: inhibiting PDGF receptors or depleting fibronectin induces mesodermal progenitors with endothelial potential.
23990986 2013 Distinct phenotypic differences associated with differential amplification of receptor tyrosine kinase genes at 4q12 in glioblastoma.
23970477 2013 Novel oncogenic PDGFRA mutations in pediatric high-grade gliomas.
23928059 2013 Dynamic and nuclear expression of PDGFR? and IGF-1R in alveolar Rhabdomyosarcoma.
23914042 2013 Rapid left ventricular thickening and thrombus caused by FIP1L1/PDGFRA-negative hypereosinophilic syndrome.
23833305 2013 Detection of mutant free circulating tumor DNA in the plasma of patients with gastrointestinal stromal tumor harboring activating mutations of CKIT or PDGFRA.
23776077 2013 PDGFR? and CD51 mark human nestin+ sphere-forming mesenchymal stem cells capable of hematopoietic progenitor cell expansion.
23761726 2013 Interrogation of the platelet-derived growth factor receptor alpha locus and corneal astigmatism in Australians of Northern European ancestry: results of a genome-wide association study.
23755839 2013 Gastrointestinal stromal tumors in children and young adults: a clinicopathologic and molecular genetic study of 22 Korean cases.
23752188 2014 PDGFRA alterations in cancer: characterization of a gain-of-function V536E transmembrane mutant as well as loss-of-function and passenger mutations.
23696935 2013 Urinary bladder urothelial carcinoma with expression of KIT and PDGFRA and showing diverse differentiations into plasmacytoid, clear cell, acantholytic, nested, and spindle variants, and into adenocarcinoma, signet-ring cell carcinoma, small cell carcinoma, large cell carcinoma, and pleomorphic carcinoma.
23696920 2013 Smooth muscles and stem cells of embryonic guts express KIT, PDGFRRA, CD34 and many other stem cell antigens: suggestion that GIST arise from smooth muscles and gut stem cells.
23671131 2013 MiR-146a enhances angiogenic activity of endothelial cells in hepatocellular carcinoma by promoting PDGFRA expression.
23630597 2013 Better prognosis of patients with glioma expressing FGF2-dependent PDGFRA irrespective of morphological diagnosis.
23621836 2013 Specific analysis of KIT and PDGFR-alpha expression and mutational status in Merkel cell carcinoma.
23621172 2013 Oncostatin M is a FIP1L1/PDGFRA-dependent mediator of cytokine production in chronic eosinophilic leukemia.
23620752 2013 The diminished expression of proangiogenic growth factors and their receptors in gastric ulcers of cirrhotic patients.
23618877 2013 Platelet derived growth factor-evoked Ca2+ wave and matrix gene expression through phospholipase C in human pulmonary fibroblast.
23612575 2014 Analysis of all subunits, SDHA, SDHB, SDHC, SDHD, of the succinate dehydrogenase complex in KIT/PDGFRA wild-type GIST.
23577108 2013 RNA interference against platelet-derived growth factor receptor ? mRNA inhibits fibroblast transdifferentiation in skin lesions of patients with systemic sclerosis.
23567961 2013 Identification of novel FLT3 kinase inhibitors.
23438035 2013 PDGFRA amplification is common in pediatric and adult high-grade astrocytomas and identifies a poor prognostic group in IDH1 mutant glioblastoma.
23411580 2013 Small cell neuroendocrine carcinoma of the esophagus: report of 6 cases with immunohistochemical and molecular genetic analysis of KIT and PDGFRA.
23401653 2013 A genome-wide association study for corneal curvature identifies the platelet-derived growth factor receptor ? gene as a quantitative trait locus for eye size in white Europeans.
23391309 2013 Progenitor cells identified by PDGFR-alpha expression in the developing and diseased human heart.
23292839 2013 Expression of NCAM (CD56), chromogranin A, synaptophysin, c-KIT (CD117) and PDGFRA in normal non-neoplastic skin and basal cell carcinoma: an immunohistochemical study of 66 consecutive cases.
23291969 2013 Molecular characterization of an Italian series of sporadic GISTs.
23243022 2013 STC1 expression by cancer-associated fibroblasts drives metastasis of colorectal cancer.
23242283 2013 PDGFRA gain in low-grade diffuse gliomas.
23171083 Clinicopathological and molecular aspects of foregut gastrointestinal stromal tumours.
23146028 2012 PDGFR?/? and VEGFR2 polymorphisms in colorectal cancer: incidence and implications in clinical outcome.
23106360 2013 Spectrum of mutations in gastrointestinal stromal tumor patients - a population-based study from Slovakia.
23074200 2012 Prevalence, clinico-pathological value, and co-occurrence of PDGFRA abnormalities in diffuse gliomas.
23064464 2012 PDGFR blockade is a rational and effective therapy for NPM-ALK-driven lymphomas.
22986233 2012 Pulmonary well-differentiated fetal adenocarcinoma with platelet-derived growth factor receptor (PDGFR)? expression.
22969067 2012 Genetic variants near PDGFRA are associated with corneal curvature in Australians.
22944561 2012 Case of polycythemia vera concurrent with FIP1L1-PDGFRA-positive myeloproliferative neoplasm with eosinophilia.
22933705 2012 Stromal platelet-derived growth factor receptor ? (PDGFR?) provides a therapeutic target independent of tumor cell PDGFR? expression in lung cancer xenografts.
22744707 2012 Platelet-derived growth factor receptor-? promotes lymphatic metastases in papillary thyroid cancer.
22718859 2012 Outcome of patients with platelet-derived growth factor receptor alpha-mutated gastrointestinal stromal tumors in the tyrosine kinase inhibitor era.
22697462 2012 B-cell depletion therapy in patients with diffuse systemic sclerosis associates with a significant decrease in PDGFR expression and activation in spindle-like cells in the skin.
22670177 2012 An immunohistochemical and molecular genetic analysis of KIT and PDGFRA in small cell lung carcinoma in Japanese.
22661233 2012 Platelet-derived growth factor receptors differentially inform intertumoral and intratumoral heterogeneity.
22650155 2012 Platelet-derived growth factor receptor ? (PDGFR?)-expressing "fibroblast-like cells" in diabetic and idiopathic gastroparesis of humans.
22593460 2012 A KIT-negative, DOG1-positive epithelioid GIST of the stomach harboring a novel PDGFRA exon 14 single nucleotide deletion.
22558483 2012 Primary small cell carcinoma of the maxillary sinus: a case report with immunohistochemical and molecular genetic study involving KIT and PDGFRA.
22543129 2012 [Role of PDGF-A/PDGFR-? in proliferation and transdifferentiation of fibroblasts from skin lesions of patients with systemic sclerosis].
22523564 2012 Identification of JAK2 as a mediator of FIP1L1-PDGFRA-induced eosinophil growth and function in CEL.
22520943 2012 Mutation in the platelet-derived growth factor receptor alpha inhibits adeno-associated virus type 5 transduction.
22473090 2012 PDGFRa mutations in humans with isolated cleft palate.
22449154 2012 Gastrointestinal stromal tumors (GISTs): role of CD 117 and PDGFRA Golgi-like staining pattern in the recognition of mutational status.
22447844 2012 Cyclin-dependent kinase 7/9 inhibitor SNS-032 abrogates FIP1-like-1 platelet-derived growth factor receptor ? and bcr-abl oncogene addiction in malignant hematologic cells.
22411791 2012 Regulation of neuroblastoma differentiation by forkhead transcription factors FOXO1/3/4 through the receptor tyrosine kinase PDGFRA.
22399613 2012 Diagnostic relevance of overexpressions of PKC-? and DOG-1 and KIT/PDGFRA gene mutations in extragastrointestinal stromal tumors: a Korean six-centers study of 28 cases.
22394371 2012 Activating PDGFRA mutations in inflammatory fibroid polyps occur in exons 12, 14 and 18 and are associated with tumour localization.
22389665 2012 Mesenchymal transition and PDGFRA amplification/mutation are key distinct oncogenic events in pediatric diffuse intrinsic pontine gliomas.
22327316 2012 PDGFRA promoter polymorphisms are associated with the risk of papillary thyroid cancer.
22323597 2012 Intratumoral heterogeneity of receptor tyrosine kinases EGFR and PDGFRA amplification in glioblastoma defines subpopulations with distinct growth factor response.
22311673 2012 Receptor tyrosine kinase genes amplified in glioblastoma exhibit a mutual exclusivity in variable proportions reflective of individual tumor heterogeneity.
22293178 2012 Heparan sulfate sulfatase SULF2 regulates PDGFR? signaling and growth in human and mouse malignant glioma.
22237707 2012 Protein expression and gene mutation status of KIT and PDGFRA in renal cell carcinoma.
22160160 2012 High KIT and PDGFRA are associated with shorter patients survival in gastroenteropancreatic neuroendocrine tumors, but mutations are a rare event.
22144915 2011 Genome-wide meta-analysis of five Asian cohorts identifies PDGFRA as a susceptibility locus for corneal astigmatism.
22137795 2011 Mosaic amplification of multiple receptor tyrosine kinase genes in glioblastoma.
22080864 2011 Activation of Rac1 by Src-dependent phosphorylation of Dock180(Y1811) mediates PDGFR?-stimulated glioma tumorigenesis in mice and humans.
22076173 2011 KIT and PDGFRA in esophageal pure small cell carcinoma.
21993628 2011 PDGF signalling controls age-dependent proliferation in pancreatic ?-cells.
21953054 2012 Frequencies of KIT and PDGFRA mutations in the MolecGIST prospective population-based study differ from those of advanced GISTs.
21947029 2011 CD140a identifies a population of highly myelinogenic, migration-competent and efficiently engrafting human oligodendrocyte progenitor cells.
21819482 2012 Markers of tyrosine kinase activity in eosinophilic esophagitis: a pilot study of the FIP1L1-PDGFR? fusion gene, pERK 1/2, and pSTAT5.
21818111 2012 Limited clinical activity of nilotinib and sorafenib in FIP1L1-PDGFRA positive chronic eosinophilic leukemia with imatinib-resistant T674I mutation.
21769672 2011 PDGF: the nuts and bolts of signalling toolbox.
21725412 2011 Challenging differential diagnosis of a wild-type gastrointestinal stromal tumour (GIST) or rare reticular perineurioma of the stomach? The role for mutational analysis.
21665993 2011 Association of variants in FRAP1 and PDGFRA with corneal curvature in Asian populations from Singapore.
21645144 2011 Platelet-derived growth factor and platelet-derived growth factor receptor-? expression in the normal human thymus and thymoma.
21642621 2011 Expression of PDGFR? is a determinant of the PVR potential of ARPE19 cells.
21605429 2011 The role of mutational analysis of KIT and PDGFRA in gastrointestinal stromal tumors in a clinical setting.
21596750 2011 The Casitas B lineage lymphoma (Cbl) mutant G306E enhances osteogenic differentiation in human mesenchymal stromal cells in part by decreased Cbl-mediated platelet-derived growth factor receptor alpha and fibroblast growth factor receptor 2 ubiquitination.
21590454 2011 Clinically relevant biomarkers to select patients for targeted inhibitor therapy after resection of hepatocellular carcinoma.
21574155 Coexpression of PDGFR-alpha, PDGFR-beta and VEGF as a prognostic factor in patients with hepatocellular carcinoma.
21527588 2012 Prognostic value of KIT/PDGFRA mutations in gastrointestinal stromal tumours (GIST): Polish Clinical GIST Registry experience.
21496277 2011 Transcriptional activation of the Axl and PDGFR-? by c-Met through a ras- and Src-independent mechanism in human bladder cancer.
21478825 2011 KIT mutations in ocular melanoma: frequency and anatomic distribution.
21461555 KIT and PDGFRA mutations and PDGFRA immunostaining in gastrointestinal stromal tumors.
21434524 2010 Fluorescence in situ hybridization analysis and immunophenotyping of c-Kit/PDGFRA and Bcl-2 expression in gastrointestinal stromal tumors.
21403518 2011 Mutations and protein expression of KIT and PDGFRA genes in ipsilateral testicular seminomas: an immunohistochemical and molecular genetic study.
21399396 2011 [Genetic mutations and molecularly-targeted drugs in hypereosinophilic syndromes].
21397860 2011 Twist1-induced invadopodia formation promotes tumor metastasis.
21396851 2013 Prognostic prediction in patients with metastatic renal cell carcinoma treated with sorafenib based on expression levels of potential molecular markers in radical nephrectomy specimens.
21387320 2011 Mutational status of KIT and PDGFRA and expression of PDGFRA are not associated with prognosis after curative resection of primary gastrointestinal stromal tumors (GISTs).
21382095 2011 Amplification of the PDGFRA, KIT and KDR genes in glioblastoma: a population-based study.
21357737 2011 Pathological signaling via platelet-derived growth factor receptor {alpha} involves chronic activation of Akt and suppression of p53.
21310211 2011 Adaptor protein Lnk binds to PDGF receptor and inhibits PDGF-dependent signaling.
21281241 2011 Concomitant FIP1L1-PDGFRA fusion gene and T-cell clonality in a case of chronic eosinophilic leukemia with clonal evolution and an incomplete response to imatinib.
21274753 2011 Gene mutations and prognostic factors analysis in extragastrointestinal stromal tumor of a Chinese three-center study.
21224473 2011 Novel imatinib-sensitive PDGFRA-activating point mutations in hypereosinophilic syndrome induce growth factor independence and leukemia-like disease.
21210262 2011 Identification of signature genes for detecting hedgehog pathway activation in esophageal cancer.
21157293 2011 Potential role of imatinib mesylate (Gleevec, STI-571) in the treatment of vestibular schwannoma.
21131919 2011 Genetic aberrations in primary esophageal melanomas: molecular analysis of c-KIT, PDGFR, KRAS, NRAS and BRAF in a series of 10 cases.
21092857 2010 NG2+ CNS glial progenitors remain committed to the oligodendrocyte lineage in postnatal life and following neurodegeneration.
21080877 2010 Expression of platelet-derived growth factor-alpha receptor in human osteosarcoma is not a predictor of outcome.
20972453 2011 The low frequency of clinical resistance to PDGFR inhibitors in myeloid neoplasms with abnormalities of PDGFRA might be related to the limited repertoire of possible PDGFRA kinase domain mutations in vitro.
20889717 2010 PDGFRA gene rearrangements are frequent genetic events in PDGFRA-amplified glioblastomas.
20861712 2010 Molecular and clinicopathologic characterization of gastrointestinal stromal tumors (GISTs) of small size.
20823768 2011 C-KIT and PDGFRA zygosity in gastrointestinal stromal tumors: Correlation with tumor site, tumor size, exon, and CD117 immunohistochemistry.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20718716 2010 Tyrosine kinase mutations in gastrointestinal stromal tumors in a nation-wide study in Iceland.
20686603 2010 The 4q12 amplicon in malignant peripheral nerve sheath tumors: consequences on gene expression and implications for sunitinib treatment.
20660204 2010 The glycoprotein B disintegrin-like domain binds beta 1 integrin to mediate cytomegalovirus entry.
20651400 2010 Prognostic relevance of KIT and PDGFRA mutations in gastrointestinal stromal tumors.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20615084 2010 Quantification of PDGFRA alternative transcripts improves the screening for X-PDGFRA fusions by reverse transcriptase-polymerase chain reaction.
20598160 2010 Pitfalls in mutational testing and reporting of common KIT and PDGFRA mutations in gastrointestinal stromal tumors.
20589679 2011 Prognostic but not predictive role of platelet-derived growth factor receptors in patients with recurrent glioblastoma.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20479398 2010 Integrated molecular genetic profiling of pediatric high-grade gliomas reveals key differences with the adult disease.
20473908 2011 Imatinib response in two GIST patients carrying two hitherto functionally uncharacterized PDGFRA mutations: an imaging, biochemical and molecular modeling study.
20470368 2010 Chromosome copy number changes carry prognostic information independent of KIT/PDGFRA point mutations in gastrointestinal stromal tumors.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20442296 2010 The alpha-receptor for platelet-derived growth factor confers bone-metastatic potential to prostate cancer cells by ligand- and dimerization-independent mechanisms.
20425130 2010 Low incidence of KIT gene mutations and no PDGFRA gene mutations in primary cutaneous melanoma: an immunohistochemical and molecular genetic study of Japanese cases.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20393746 2010 Comparison of morphological, immunohistochemical, and molecular genetic features of inflammatory fibroid polyps (Vanek's tumors).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20169295 2010 Platelet-derived growth factor receptor alpha gene mutations in vitiligo vulgaris.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20133985 Synchronous presentation of GISTs and other primary neoplasms: a single center experience.
20129251 2010 Integrated genomic analysis identifies clinically relevant subtypes of glioblastoma characterized by abnormalities in PDGFRA, IDH1, EGFR, and NF1.
20107158 2010 Screening for diverse PDGFRA or PDGFRB fusion genes is facilitated by generic quantitative reverse transcriptase polymerase chain reaction analysis.
20071345 2010 Dysregulation of the PDGFRA gene causes inflow tract anomalies including TAPVR: integrating evidence from human genetics and model organisms.
20036812 2010 Growth factors in tumor microenvironment.
20023271 2010 Detection of c-KIT and PDGFRA gene mutations in gastrointestinal stromal tumors: comparison of DHPLC and DNA sequencing methods using a single population-based cohort.
20001342 2009 Expression of platelet-derived growth factor-alpha receptor and c-kit in giant cell tumours of bone.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19946888 2010 Defining the membrane proteome of NK cells.
19943934 2009 Functional features of gene expression profiles differentiating gastrointestinal stromal tumours according to KIT mutations and expression.
19936766 2010 K-ras mutation status correlates with the expression of VEGFR1, VEGFR2, and PDGFRalpha in colorectal cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19900103 2009 Pathological characteristics of gastrointestinal stromal tumours with PDGFRA mutations.
19862822 2010 Frequent deletion of CDKN2A and recurrent coamplification of KIT, PDGFRA, and KDR in fibrosarcoma of bone--an array comparative genomic hybridization study.
19861461 2009 Prognostic significance of molecular markers and extent of resection in primary glioblastoma patients.
19846951 2009 Expression and mutational status of PDGFR in thymic tumours.
19843560 2010 An automated and multiplexed method for high throughput peptide immunoaffinity enrichment and multiple reaction monitoring mass spectrometry-based quantification of protein biomarkers.
19839721 2010 Platelet-derived growth factor receptor signaling is not involved in osteogenic differentiation of human mesenchymal stem cells.
19787330 2009 [Pathology and molecular biology of gastrointestinal stromal tumors (GIST)].
19779861 2010 Amplification and overexpression of KIT, PDGFRA, and VEGFR2 in medulloblastomas and primitive neuroectodermal tumors.
19756614 2009 [Inflammatory fibroid polyps are true neoplasms with PDGFRA mutations].
19755855 2009 Amplification of chromosomal segment 4q12 in non-small cell lung cancer.
19717644 2009 Platelet-derived growth factor receptor expression and activation in choroid plexus tumors.
19707201 2009 Expression, mutation and copy number analysis of platelet-derived growth factor receptor A (PDGFRA) and its ligand PDGFA in gliomas.
19696981 2009 [Gastrointestinal stomal tumours, morphology and molecular pathology].
19694830 2009 Expression and mutational analyses of KIT and PDGFR-alpha in sarcomatoid renal cell carcinoma.
19675092 2010 Pharmacological management of gastrointestinal stromal tumours: an update on the role of sunitinib.
19649203 2009 Platelet-derived growth factor-receptor alpha strongly inhibits melanoma growth in vitro and in vivo.
19648886 2009 Ezrin overexpression in gastrointestinal stromal tumors: an independent adverse prognosticator associated with the non-gastric location.
19644140 2009 The fusion proteins TEL-PDGFRbeta and FIP1L1-PDGFRalpha escape ubiquitination and degradation.
19614767 2009 Low frequency of MAP kinase pathway alterations in KIT and PDGFRA wild-type GISTs.
19563658 2009 Molecular characterization of EGFR, PDGFRA and VEGFR2 in cervical adenosquamous carcinoma.
19496203 2009 Amelanotic malignant melanoma of the esophagus: report of two cases with immunohistochemical and molecular genetic study of KIT and PDGFRA.
19448595 2009 Gain-of-function PDGFRA mutations, earlier reported in gastrointestinal stromal tumors, are common in small intestinal inflammatory fibroid polyps. A study of 60 cases.
19411681 2009 Kinase mutations and efficacy of imatinib in Korean patients with advanced gastrointestinal stromal tumors.
19393245 2009 NMR structural studies on human p190-A RhoGAPFF1 revealed that domain phosphorylation by the PDGF-receptor alpha requires its previous unfolding.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19335066 2009 PDGFRalpha: a new therapeutic target in the treatment of hepatocellular carcinoma?
19333949 2009 Lack of evidence of stimulatory autoantibodies to platelet-derived growth factor receptor in patients with systemic sclerosis.
19333919 2009 Lack of detection of agonist activity by antibodies to platelet-derived growth factor receptor alpha in a subset of normal and systemic sclerosis patient sera.
19333543 2009 Interstitial cells of Cajal do not harbor c-kit or PDGFRA gene mutations in patients with sporadic gastrointestinal stromal tumors.
19326424 2009 Sunitinib treatment in pediatric patients with advanced GIST following failure of imatinib.
19307738 2009 A prospective, multicenter, phase 2 study of imatinib mesylate in korean patients with metastatic or unresectable gastrointestinal stromal tumor.
19302534 2009 Expression and molecular analysis of c-kit and PDGFRs in Kaposi's sarcoma of different stages and epidemiological settings.
19291337 2009 Impact of KIT and PDGFRA gene mutations on prognosis of patients with gastrointestinal stromal tumors after complete primary tumor resection.
19248967 2009 Inherited predisposition to gastrointestinal stromal tumor.
19215021 2009 Interaction of PDGFRA promoter haplotypes and maternal environmental exposures in the risk of spina bifida.
19212337 2009 FIP1L1-PDGFRalpha D842V, a novel panresistant mutant, emerging after treatment of FIP1L1-PDGFRalpha T674I eosinophilic leukemia with single agent sorafenib.
19126548 2009 Growth factors outside of the platelet-derived growth factor (PDGF) family employ reactive oxygen species/Src family kinases to activate PDGF receptor alpha and thereby promote proliferation and survival of cells.
19118897 2009 Validation of a new three-color fluorescence in situ hybridization (FISH) method to detect CHIC2 deletion, FIP1L1/PDGFRA fusion and PDGFRA translocations.
19115205 2009 Combined anti-PDGFRalpha and PDGFRbeta targeting in non-small cell lung cancer.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19047372 2009 Sustained platelet-derived growth factor receptor alpha signaling in osteoblasts results in craniosynostosis by overactivating the phospholipase C-gamma pathway.
19035305 Molecular analysis of PDGFRA and PDGFRB genes by rapid single-strand conformation polymorphism (SSCP) in patients with core-binding factor leukaemias with KIT or FLT3 mutation.
18992915 2009 Peroxiredoxin I, platelet-derived growth factor A, and platelet-derived growth factor receptor alpha are overexpressed in carcinoma ex pleomorphic adenoma: association with malignant transformation.
18987651 2009 The molecular anatomy of the FIP1L1-PDGFRA fusion gene.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18955458 2008 Primary and secondary kinase genotypes correlate with the biological and clinical activity of sunitinib in imatinib-resistant gastrointestinal stromal tumor.
18950958 2009 Histological expression of angiogenic factors: VEGF, PDGFRalpha, and HIF-1alpha in Hodgkin lymphoma.
18758297 2008 Prognostic impact of platelet-derived growth factors in non-small cell lung cancer tumor and stromal cells.
18706197 2008 FIP1L1-PDGFRalpha alone or with other genetic abnormalities reveals disease progression in chronic eosinophilic leukemia but good response to imatinib.
18701889 2008 Platelet-derived growth factor-alpha receptor activation is required for human cytomegalovirus infection.
18686281 2008 Inflammatory fibroid polyps harbour mutations in the platelet-derived growth factor receptor alpha (PDGFRA) gene.
18679424 2008 PDGFR-A is a therapeutic target in alveolar rhabdomyosarcoma.
18636362 2008 [Status and clinical analysis of c-kit and PDGFRA mutations in the gastrointestinal stromal tumors].
18633616 2008 The expression and prognostic significance of platelet-derived growth factor receptor alpha in mature T- and natural killer-cell lymphomas.
18618605 2008 The analysis of status and clinical implication of KIT and PDGFRA mutations in gastrointestinal stromal tumor (GIST).
18615679 2008 Novel V600E BRAF mutations in imatinib-naive and imatinib-resistant gastrointestinal stromal tumors.
18548106 2008 Novel gain-of-function mutation in the extracellular domain of the PDGFRA gene in infant acute lymphoblastic leukemia with t(4;11)(q21;q23).
18547963 2008 PDGFRalpha gene mutation and protein expression in gastrointestinal stromal tumors.
18519768 2008 Protein expression of platelet-derived growth factor receptor correlates with malignant histology and PTEN with survival in childhood gliomas.
18492696 2008 Expression of c-kit and platelet-derived growth factor receptors in ovarian granulosa cell tumors.
18483217 2008 Role of platelet-derived growth factors in physiology and medicine.
18464291 2008 Haplotype-specific expression of the human PDGFRA gene correlates with the risk of glioblastomas.
18416137 2007 [c-Kit and PDGFRA mutations and clinico-morphological features of gastrointestinal stromal tumors].
18360281 2008 PDGFRA immunostaining can help in the diagnosis of gastrointestinal stromal tumors.
18331602 2008 Platelet-derived growth factor may be associated with fibrosis in a Down syndrome patient with transient myeloproliferative disorder.
18326546 2008 Platelet-derived growth factors (PDGF-A and -B) and their receptors in human fetal and adult ovaries.
18314611 2007 [Activating mutations in receptor tyrosine kinases with relevance for treatment of gastrointestinal stromal tumors].
18312355 2008 Clinical significance of oncogenic KIT and PDGFRA mutations in gastrointestinal stromal tumours.
18288404 2008 PDGFRalpha/beta expression correlates with the metastatic behavior of human colorectal cancer: a possible rationale for a molecular targeting strategy.
18284546 2008 Expression of platelet-derived growth factor-AA and platelet-derived growth factor-alpha receptor in ameloblastomas.
18265649 2007 Analysis of mutation and expression of c-kit and PDGFR-alpha gene in gastrointestinal stromal tumor.
18197502 2008 [Expression and gene mutation of phospho-platelet derived growth factor receptor alpha and C-kit in gastrointestinal and extra-gastrointestinal stromal tumors].
18193045 2008 Common variants in the GDF5-UQCC region are associated with variation in human height.
18190445 2008 Platelet-derived growth factor receptor alpha mutational status and immunohistochemical expression in Merkel cell carcinoma: implications for treatment with imatinib mesylate.
18187489 2008 KIT and PDGFRalpha mutations in 104 patients with gastrointestinal stromal tumors (GISTs): a population-based study.
18157090 2008 Platelet-derived growth factor receptor expression and amplification in choroid plexus carcinomas.
18084259 2008 Silent mutations in KIT and PDGFRA and coexpression of receptors with SCF and PDGFA in Merkel cell carcinoma: implications for tyrosine kinase-based tumorigenesis.
18077793 2008 A new look at platelet-derived growth factor in renal disease.
18070887 2008 Phosphatidylinositol 3-kinase-dependent membrane recruitment of Rac-1 and p47phox is critical for alpha-platelet-derived growth factor receptor-induced production of reactive oxygen species.
18042065 2007 KIT and PDGFRalpha mutational analyses of mixed cell-type gastrointestinal stromal tumours.
17881156 2007 Transcriptional regulation of a new variant of human platelet-derived growth factor receptor alpha transcript by E2F-1.
17827398 2008 Molecular alterations of KIT and PDGFRA in GISTs: evaluation of a Portuguese series.
17762857 2008 Absence of PDGFRA mutations in primary melanoma.
17701174 2007 A multicenter analysis of the FIP1L1-alphaPDGFR fusion gene in Japanese idiopathic hypereosinophilic syndrome: an aberrant splicing skipping the alphaPDGFR exon 12.
17690840 2008 Expression of oligodendroglial differentiation markers in pilocytic astrocytomas identifies two clinical subsets and shows a significant correlation with proliferation index and progression free survival.
17673922 2007 Site-dependent differential KIT and PDGFRA expression in gastric and intestinal gastrointestinal stromal tumors.
17623951 2006 An immunohistochemical and molecular study of gastrointestinal stromal tumours.
17604334 2007 Platelet-derived growth factor receptor-alpha: a novel therapeutic target in human hepatocellular cancer.
17591942 2007 A case of FIP1L1-PDGFRA-positive chronic eosinophilic leukemia with a rare FIP1L1 breakpoint.
17568391 2007 Candidate genes for congenital diaphragmatic hernia from animal models: sequencing of FOG2 and PDGFRalpha reveals rare variants in diaphragmatic hernia patients.
17566086 2007 Multiple gastrointestinal stromal and other tumors caused by platelet-derived growth factor receptor alpha gene mutations: a case associated with a germline V561D defect.
17532173 2008 Spectrum and prognostication of KIT and PDGFRA mutation in gastrointestinal stromal tumors.
17470632 2007 Vascular endothelial growth factor can signal through platelet-derived growth factor receptors.
17448020 2007 Expression of platelet-derived growth factor receptor in low-grade endometrial stromal sarcomas in the absence of activating mutations.
17438095 2007 c-Kit/PDGFRA gene status alterations possibly related to primary imatinib resistance in gastrointestinal stromal tumors.
17419949 2007 PDGF receptors as targets in tumor treatment.
17377585 2007 Recurrent finding of the FIP1L1-PDGFRA fusion gene in eosinophilia-associated acute myeloid leukemia and lymphoblastic T-cell lymphoma.
17363728 2007 Stimulatory autoantibodies to PDGF receptor in patients with extensive chronic graft-versus-host disease.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17344284 2007 Human cytomegalovirus downregulates expression of receptors for platelet-derived growth factor by smooth muscle cells.
17299092 2007 Low-dose imatinib mesylate leads to rapid induction of major molecular responses and achievement of complete molecular remission in FIP1L1-PDGFRA-positive chronic eosinophilic leukemia.
17298867 2007 Protein expression of KIT and gene mutation of c-kit and PDGFRs in Ewing sarcomas.
17261495 2007 Clinical features of hypereosinophilic syndrome: FIP1L1-PDGFRA fusion gene-positive disease is a distinct clinical entity with myeloproliferative features and a poor response to corticosteroid.
17214097 2006 A clonal hypereosinophilic syndrome with specific and effective therapy: a report of two cases.
17193822 2006 KIT and PDGFRA mutations in gastrointestinal stromal tumors (GISTs).
17145809 2006 Molecular and biochemical analyses of platelet-derived growth factor receptor (PDGFR) B, PDGFRA, and KIT receptors in chordomas.
17141222 2006 PI3-kinase/Akt-dependent antiapoptotic signaling by the PDGF alpha receptor is negatively regulated by Src family kinases.
17137731 2007 FIP1L1-PDGFRA positive chronic eosinophilic leukemia in Tunisian patients.
17079230 2007 The platelet-derived growth factor receptor alpha is destabilized by geldanamycins in cancer cells.
17070723 2007 Platelet-derived growth factor receptor-alpha is a key determinant of smooth muscle alpha-actin filaments in bone marrow-derived mesenchymal stem cells.
17047316 2006 Expression of tyrosine kinase receptors in malignant midgut carcinoid tumors.
16892550 2004 [Gastrointestinal stromal tumors carrying PDGFRalpha mutations occur preferentially in the stomach and exhibit an epithelioid or mixed phenotype].
16850112 2006 Expression of survivin, platelet-derived growth factor A (PDGF-A) and PDGF receptor alpha in primary central nervous system lymphoma.
16804324 2006 Variant in promoter region of platelet-derived growth factor receptor-alpha (PDGFRalpha) gene is associated with the severity and allergic status of childhood asthma.
16785193 2006 Platelet-derived growth factor receptor family mutations in gastrointestinal stromal tumours.
16730575 2006 Genetic polymorphism in platelet-derived growth factor and vascular endothelial growth factor are significantly associated with cardiac allograft vasculopathy.
16697720 2006 Gastrointestinal stromal tumors with KIT exon 11 deletions are associated with poor prognosis.
16690743 2006 Activation of FIP1L1-PDGFRalpha requires disruption of the juxtamembrane domain of PDGFRalpha and is FIP1L1-independent.
16685437 2006 Deletion of the KIT gene is associated with liver metastasis and poor prognosis in patients with gastrointestinal stromal tumor in the stomach.
16675559 2006 Tumor-driven paracrine platelet-derived growth factor receptor alpha signaling is a key determinant of stromal cell recruitment in a model of human lung carcinoma.
16502585 2006 Detection of the FIP1L1-PDGFRA fusion in idiopathic hypereosinophilic syndrome and chronic eosinophilic leukemia.
16498388 2006 Identification of a novel imatinib responsive KIF5B-PDGFRA fusion gene following screening for PDGFRA overexpression in patients with hypereosinophilia.
16373964 2005 Molecular characterization of PDGFR-alpha/PDGF-A and c-KIT/SCF in gliosarcomas.
16357008 2006 Mutation and expression of PDGFRA and KIT in malignant peripheral nerve sheath tumors, and its implications for imatinib sensitivity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16331269 2006 Autocrine activation of PDGFRalpha promotes the progression of ovarian cancer.
16305343 2005 Alteration on the expression of IL-1, PDGF, TGF-beta, EGF, and FGF receptors and c-Fos and c-Myc proteins in bone marrow mesenchymal stroma cells from advanced untreated lung and breast cancer patients.
16283668 2005 Promotor genotype of the platelet-derived growth factor receptor-alpha gene shows population stratification but not association with spina bifida meningomyelocele.
16186508 2005 Sequence survey of receptor tyrosine kinases reveals mutations in glioblastomas.
16168125 2005 Overexpression of platelet-derived growth factor receptor alpha in breast cancer is associated with tumour progression.
16135486 2005 Deletions affecting codons 557-558 of the c-KIT gene indicate a poor prognosis in patients with completely resected gastrointestinal stromal tumors: a study by the Spanish Group for Sarcoma Research (GEIS).
16126374 2005 Haplotype-dependent binding of nuclear proteins to the promoter of the neural tube defects-associated platelet-derived growth factor alpha-receptor gene.
16116920 2005 [FIP1L1-PDGFRalpha-positive myeloproliferative disease with hypereosinophilia: clinical characteristics and pathogenetic therapy].
15928335 2005 PDGFRA mutations in gastrointestinal stromal tumors: frequency, spectrum and in vitro sensitivity to imatinib.
15897742 2005 Gastrointestinal stromal tumors of neurofibromatosis type I (von Recklinghausen's disease).
15894928 2005 Epithelioid gastrointestinal stromal tumor with PDGFRA activating mutation and immunoreactivity.
15871904 2006 IFNgamma regulates PDGF-receptor alpha expression in macrophages, THP-1 cells, and arterial smooth muscle cells.
15862965 2005 Calcitriol inhibits growth response to Platelet-Derived Growth Factor-BB in human prostate cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15791568 2005 Expression and mutational analysis of tyrosine kinase receptors c-kit, PDGFRalpha, and PDGFRbeta in ovarian cancers.
15685537 2005 Mechanisms of resistance to imatinib mesylate in gastrointestinal stromal tumors and activity of the PKC412 inhibitor against imatinib-resistant mutants.
15674355 2005 Novel missense mutations in the tyrosine kinase domain of the platelet-derived growth factor receptor alpha(PDGFRA) gene in childhood acute myeloid leukemia with t(8;21)(q22;q22) or inv(16)(p13q22).
15635072 2005 A PDGFRA promoter polymorphism, which disrupts the binding of ZNF148, is associated with primitive neuroectodermal tumours and ependymomas.
15492989 2004 Myxoid epithelioid gastrointestinal stromal tumor (GIST) with mast cell infiltrations: a subtype of GIST with mutations of platelet-derived growth factor receptor alpha gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380338 2004 Development of hygromas or severe edema during treatment with the tyrosine kinase inhibitor STI571 is not associated with platelet-derived growth factor receptor (PDGFR) gene polymorphisms.
15326474 2004 Gastrointestinal stromal tumors (GISTs) with KIT and PDGFRA mutations have distinct gene expression profiles.
15284118 2004 FIP1L1-PDGFRA fusion: prevalence and clinicopathologic correlates in 89 consecutive patients with moderate to severe eosinophilia.
15207817 2004 PDGF receptors-mediators of autocrine tumor growth and regulators of tumor vasculature and stroma.
15154005 2004 Differential expression of KIT/PDGFRA mutant isoforms in epithelioid and mixed variants of gastrointestinal stromal tumors depends predominantly on the tumor site.
14766209 2004 C/EBP is an essential component of PDGFRA transcription in MG-63 cells.
14745431 2004 High incidence of BCR-ABL kinase domain mutations and absence of mutations of the PDGFR and KIT activation loops in CML patients with secondary resistance to imatinib.
14741194 2004 Promoter haplotype combinations for the human PDGFRA gene are associated with risk of neural tube defects.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14644164 2003 The role of c-Src in platelet-derived growth factor alpha receptor internalization.
14630792 2004 The EOL-1 cell line as an in vitro model for the study of FIP1L1-PDGFRA-positive chronic eosinophilic leukemia.
12842979 2003 CHIC2 deletion, a surrogate for FIP1L1-PDGFRA fusion, occurs in systemic mastocytosis associated with eosinophilia and predicts response to imatinib mesylate therapy.
12808148 2003 Discovery of a fusion kinase in EOL-1 cells and idiopathic hypereosinophilic syndrome.
12660384 2003 A tyrosine kinase created by fusion of the PDGFRA and FIP1L1 genes as a therapeutic target of imatinib in idiopathic hypereosinophilic syndrome.
12522257 2003 PDGFRA activating mutations in gastrointestinal stromal tumors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176024 2002 Platelet-derived growth factor-B and -C and active alpha-receptors in medulloblastoma cells.
12119411 2002 Molecular portraits of B cell lineage commitment.
11953315 2002 The oligodendrocyte precursor mitogen PDGF stimulates proliferation by activation of alpha(v)beta3 integrins.
11882663 2002 Structural determinants of the Na+/H+ exchanger regulatory factor interaction with the beta 2 adrenergic and platelet-derived growth factor receptors.
11776032 2000 Modulation of transforming growth factor beta to platelet-derived growth factor receptor-alpha of human osteoblasts.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11468294 2001 Mapping of a region within the N terminus of Jak1 involved in cytokine receptor interaction.
11342471 2001 Chromosomal location, exon structure, and vascular expression patterns of the human PDGFC and PDGFD genes.
11297552 2001 Platelet-derived growth factor C (PDGF-C), a novel growth factor that binds to PDGF alpha and beta receptor.
11279102 2001 Sorting nexin 6, a novel SNX, interacts with the transforming growth factor-beta family of receptor serine-threonine kinases.
11175793 2001 Promoter haplotype combinations of the platelet-derived growth factor alpha-receptor gene predispose to human neural tube defects.
11095946 2000 Shf, a Shb-like adapter protein, is involved in PDGF-alpha-receptor regulation of apoptosis.
11046132 2000 Platelet-derived growth factor receptor association with Na(+)/H(+) exchanger regulatory factor potentiates receptor activity.
10947961 2000 Platelet-derived-growth-factor-induced signalling in human platelets: phosphoinositide-3-kinase-dependent inhibition of platelet activation.
10837138 2000 Platelet-derived growth factor-mediated signaling through the Shb adaptor protein: effects on cytoskeletal organization.
10806482 2000 PDGF-C is a new protease-activated ligand for the PDGF alpha-receptor.
10734113 2000 Src family kinases negatively regulate platelet-derived growth factor alpha receptor-dependent signaling and disease progression.
10733900 2000 Differential interaction of CrkII adaptor protein with platelet-derived growth factor alpha- and beta-receptors is determined by its internal tyrosine phosphorylation.
10508235 1999 Mechanism of action and in vivo role of platelet-derived growth factor.
10066366 1999 Caveolin is an inhibitor of platelet-derived growth factor receptor signaling.
9819414 1998 Identification of a family of sorting nexin molecules and characterization of their association with receptors.
9739761 1998 Signal transduction via platelet-derived growth factor receptors.
9546424 1998 Identification of Tyr-762 in the platelet-derived growth factor alpha-receptor as the binding site for Crk proteins.
9484840 1998 Activation of Stat5 by platelet-derived growth factor (PDGF) is dependent on phosphorylation sites in PDGF beta-receptor juxtamembrane and kinase insert domains.
8943348 1996 Phosphorylation of tyrosine 720 in the platelet-derived growth factor alpha receptor is required for binding of Grb2 and SHP-2 but not for activation of Ras or cell proliferation.
8940081 1996 Grb7 is a downstream signaling component of platelet-derived growth factor alpha- and beta-receptors.
8894141 1996 Distribution of platelet-derived growth factor (PDGF) A chain mRNA, protein, and PDGF-alpha receptor in rapidly forming human bone.
8774134 1996 Expression of platelet-derived growth factor and its receptors in normal human liver and during active hepatic fibrogenesis.
8760137 1996 Maximal PDGF-induced lung fibroblast chemotaxis requires PDGF receptor-alpha.
8702949 1996 Binding to the platelet-derived growth factor receptor transiently activates the p85alpha-p110alpha phosphoinositide 3-kinase complex in vivo.
8647858 1996 Cloning and characterization of GRB14, a novel member of the GRB7 gene family.
8647855 1996 Modulation of the SH2 binding specificity and kinase activity of Src by tyrosine phosphorylation within its SH2 domain.
8643452 1996 The platelet-derived growth factor alpha-receptor is encoded by a growth-arrest-specific (gas) gene.
8617789 1996 Structural determinants in the platelet-derived growth factor alpha-receptor implicated in modulation of chemotaxis.
8586421 1995 Structure, organization, and transcription units of the human alpha-platelet-derived growth factor receptor gene, PDGFRA.
8486649 1993 Identification of a soluble receptor for platelet-derived growth factor in cell-conditioned medium and human plasma.
8261442 1994 Developmentally regulated expression of two novel platelet-derived growth factor alpha-receptor transcripts in human teratocarcinoma cells.
8188664 1994 Negative feedback regulation of human platelets via autocrine activation of the platelet-derived growth factor alpha-receptor.
7896447 1995 Receptor tyrosine kinases expressed in metastatic colon cancer.
7679113 1993 Mechanism of platelet-derived growth factor (PDGF) AA, AB, and BB binding to alpha and beta PDGF receptor.
7665222 1995 Induction of platelet-derived growth factor A and B chains and over-expression of their receptors in human pancreatic cancer.
7535778 1995 Demonstration of functionally different interactions between phospholipase C-gamma and the two types of platelet-derived growth factor receptors.
7523122 1994 A unique autophosphorylation site in the platelet-derived growth factor alpha receptor from a heterodimeric receptor complex.
7519254 1994 Plasticity in the adult human oligodendrocyte lineage.
2554309 1989 Independent expression of human alpha or beta platelet-derived growth factor receptor cDNAs in a naive hematopoietic cell leads to functional coupling with mitogenic and chemotactic signaling pathways.
2544881 1989 cDNA cloning and expression of the human A-type platelet-derived growth factor (PDGF) receptor establishes structural similarity to the B-type PDGF receptor.
2542288 1989 Two different subunits associate to create isoform-specific platelet-derived growth factor receptors.
2536956 1989 Isolation of a novel receptor cDNA establishes the existence of two PDGF receptor genes.
2531695 1989 An efficient directional cloning system to construct cDNA libraries containing full-length inserts at high frequency.
2173144 1990 Binding of SH2 domains of phospholipase C gamma 1, GAP, and Src to activated growth factor receptors.
2161888 1990 Platelet-derived growth factor receptor: current views of the two-subunit model.
1847074 1991 Ligand-induced interaction between alpha- and beta-type platelet-derived growth factor (PDGF) receptors: role of receptor heterodimers in kinase activation.
1711435 1991 Chromosomal localization of the gene for AA-type platelet-derived growth factor receptor (PDGFRA) in humans and mice.
1709159 1991 Platelet-derived growth factor (PDGF) stimulates PDGF receptor subunit dimerization and intersubunit trans-phosphorylation.
1646396 1991 Tyrosine mutations within the alpha platelet-derived growth factor receptor kinase insert domain abrogate receptor-associated phosphatidylinositol-3 kinase activity without affecting mitogenic or chemotactic signal transduction.