Property Summary

Ligand Count 137
NCBI Gene PubMed Count 427
PubMed Score 809.93
PubTator Score 1015.31

Knowledge Summary

Patent (32,454)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Globe disease 67 0.0 3.0
Refractive error 50 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 5.795 2.9

Expression

  Differential Expression (31)

Disease log2 FC p
lung cancer -1.500 2.0e-04
Breast cancer -2.800 1.3e-12
adrenocortical adenoma -1.433 1.6e-02
adrenocortical carcinoma -4.049 1.5e-06
astrocytic glioma 1.600 2.0e-02
Astrocytoma, Pilocytic 3.500 1.3e-07
Atopic dermatitis -1.400 6.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.003 4.1e-02
breast carcinoma -1.500 2.1e-05
colon cancer -1.900 1.1e-02
cystic fibrosis -2.882 1.3e-06
Duchenne muscular dystrophy 1.680 3.5e-07
ductal carcinoma in situ -1.100 3.5e-03
glioblastoma 2.000 5.4e-03
group 3 medulloblastoma -2.300 3.9e-02
intraductal papillary-mucinous carcinoma... -2.500 2.7e-02
intraductal papillary-mucinous neoplasm ... -4.200 2.1e-03
invasive ductal carcinoma -1.900 8.8e-05
lung adenocarcinoma -1.600 2.7e-08
lung carcinoma -2.700 1.9e-20
malignant mesothelioma -5.600 1.9e-09
medulloblastoma, large-cell -2.700 6.6e-04
oligodendroglioma 2.500 1.5e-02
osteosarcoma -1.071 7.4e-03
ovarian cancer -4.400 3.6e-10
pancreatic cancer 1.800 4.5e-03
pancreatic ductal adenocarcinoma liver m... -1.016 2.4e-02
pituitary cancer -3.900 1.3e-13
primary Sjogren syndrome 1.100 8.3e-03
psoriasis -1.100 6.8e-04
ulcerative colitis 1.800 4.1e-04

Protein-protein Interaction (1)

Gene RIF (374)

AA Sequence

MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVE      1 - 70
IRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIV     71 - 140
EDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKA    141 - 210
TSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEA    211 - 280
TVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWL    281 - 350
KNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDL    351 - 420
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHSRDRSTVEGRVTF    421 - 490
AKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWR    491 - 560
VIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLK    561 - 630
PTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEK    631 - 700
PKKELDIFGLNPADESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKK    701 - 770
KSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA    771 - 840
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIK    841 - 910
SGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARM    911 - 980
RVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAI    981 - 1050
ETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL                                  1051 - 1089
//

Text Mined References (444)

PMID Year Title