Property Summary

Ligand Count 1,122
NCBI Gene PubMed Count 84
PubMed Score 2270.41
PubTator Score 1655.98

Knowledge Summary


No data available


  Disease (5)

Disease Target Count Z-score Confidence
Neoplasm Metastasis 168 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7


  Differential Expression (21)

Disease log2 FC p
diabetes mellitus -1.200 9.2e-03
atypical teratoid / rhabdoid tumor 1.200 4.2e-04
Breast cancer -3.300 3.3e-17
breast carcinoma -1.300 6.7e-25
colon cancer -1.800 1.4e-02
gastric cancer 1.300 9.4e-03
head and neck cancer -2.000 3.4e-02
lung adenocarcinoma -1.500 1.3e-13
lung cancer 1.200 9.1e-04
malignant mesothelioma -3.800 4.6e-08
medulloblastoma 1.800 1.1e-02
medulloblastoma, large-cell 1.300 9.0e-06
non-small cell lung cancer -1.977 6.3e-21
osteosarcoma 1.530 3.4e-05
ovarian cancer 1.600 2.6e-11
pancreatic cancer 1.600 2.0e-03
pancreatic carcinoma 1.600 2.0e-03
pituitary cancer 1.900 1.4e-02
posterior fossa group A ependymoma 1.500 9.3e-10
type II diabetes mellitus and post-ische... 1.300 3.3e-02
ulcerative colitis -1.200 2.4e-04

PDB (35)

Gene RIF (56)

AA Sequence

PLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN                                       841 - 875

Text Mined References (88)

PMID Year Title