Property Summary

NCBI Gene PubMed Count 81
PubMed Score 2168.99
PubTator Score 1655.98

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Neoplasm Metastasis 138
Disease Target Count P-value
breast carcinoma 1614 6.68292868927031E-25
non-small cell lung cancer 2798 6.31007707768754E-21
lung adenocarcinoma 2714 9.78025622058261E-18
Breast cancer 3099 3.27626193123111E-17
ovarian cancer 8492 1.35736190143334E-14
posterior fossa group A ependymoma 1511 9.27615277696453E-10
malignant mesothelioma 3163 4.64031882148976E-8
osteosarcoma 7933 6.07703549319117E-8
sonic hedgehog group medulloblastoma 1482 2.38818260252988E-7
medulloblastoma, large-cell 6234 8.7753188368799E-5
ulcerative colitis 2087 2.37807628530774E-4
lung cancer 4473 9.0510222052435E-4
pancreatic carcinoma 567 0.00204576034794747
pancreatic cancer 2300 0.00204576034794748
atypical teratoid / rhabdoid tumor 4369 0.00541053851941391
gastric cancer 436 0.00941298068103946
pituitary cancer 1972 0.0141178402601435
colon cancer 1475 0.014142796935881
type II diabetes mellitus and post-ischemic heart failure 89 0.0329410717829601
head and neck cancer 270 0.0339700900977382


  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.300 0.009
pancreatic cancer 1.600 0.002
malignant mesothelioma -3.800 0.000
osteosarcoma 2.317 0.000
sonic hedgehog group medulloblastoma 3.600 0.000
type II diabetes mellitus and post-ische... 1.300 0.033
atypical teratoid / rhabdoid tumor 1.900 0.005
medulloblastoma, large-cell 1.400 0.000
non-small cell lung cancer -1.977 0.000
colon cancer -1.800 0.014
lung cancer 1.200 0.001
diabetes mellitus -1.200 0.009
lung adenocarcinoma -1.700 0.000
posterior fossa group A ependymoma 1.500 0.000
pancreatic carcinoma 1.600 0.002
breast carcinoma -1.300 0.000
Breast cancer -3.300 0.000
ulcerative colitis -1.200 0.000
ovarian cancer -2.900 0.000
pituitary cancer 1.900 0.014
head and neck cancer -2.000 0.034


Accession O76074 A0AV69 A8K2C4 O75026 O75887 Q86UI0 Q86V66 Q9Y6Z6
Symbols CN5A


PANTHER Protein Class (2)


3JWQ   3JWR   1RKP   1T9R   1T9S   1TBF   1UDT   1UDU   1UHO   1XOZ   1XP0   2CHM   2H40   2H42   2H44   2XSS   3B2R   3BJC   3HC8   3HDZ   3LFV   3MF0   3SHY   3SHZ   3SIE   3TGE   3TGG   4G2W   4G2Y   4I9Z   4IA0   4MD6   4OEW   4OEX  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Horse OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (53)

26657792 Our data showed a significant and previously undocumented upregulation of PDE5 in both rat and human BPH.
26299804 cGMP PDE isozymes, PDE5 and 10, are elevated in colon tumor cells compared with normal colonocytes, and inhibitors and siRNAs can selectively suppress colon tumor cell growth
25837309 Overexpression of PDE5 in papillary thyroid carcinomas.
25322361 PDE5A appears to jointly influence amygdala volume and emotion recognition performance.
25247292 Results show that Ser102 and Ser104 may influence the conformational flexibility of PDE5A, which may in turn influence phosphorylation status, allosteric regulation by cGMP or other as yet unknown regulatory mechanisms for PDE5A.
24112792 inhibition of PDE5 can counteract apoptosis during aging by modulating proand antiapoptotic molecules and the APP pathway.
23527037 Myocardial PDE5 expression is increased in the hearts of humans and mice with chronic pressure overload.
23033484 analysis of amino acid residues responsible for the selectivity of tadalafil binding to two closely related phosphodiesterases, PDE5 and PDE6
22960860 it is concluded that assessment of PDE5 and PDE9 expression may be useful in the differential diagnosis of benign and malignant breast disease and successful treatment of breast cancer
22843873 PDE5 is highly expressed and increases ( approximately 130%) during growth whereas ABCC5 exhibited low to moderate expression, with a moderate increase ( approximately 40%) during growth

AA Sequence

PLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN                                       841 - 875

Text Mined References (85)

PMID Year Title
26657792 2015 Upregulation of Phosphodiesterase type 5 in the Hyperplastic Prostate.
26299804 2015 Suppression of ?-catenin/TCF transcriptional activity and colon tumor cell growth by dual inhibition of PDE5 and 10.
25837309 2015 PDE5 expression in human thyroid tumors and effects of PDE5 inhibitors on growth and migration of cancer cells.
25799991 2015 Phosphodiesterase 9A controls nitric-oxide-independent cGMP and hypertrophic heart disease.
25322361 2015 Pleiotropic locus for emotion recognition and amygdala volume identified using univariate and bivariate linkage.
25247292 2014 Role of Ser102 and Ser104 as regulators of cGMP hydrolysis by PDE5A.
24112792 2014 Effect of phosphodiesterase-5 inhibition on apoptosis and beta amyloid load in aged mice.
23527037 2013 Increased cardiac myocyte PDE5 levels in human and murine pressure overload hypertrophy contribute to adverse LV remodeling.
23033484 2012 Identification of amino acid residues responsible for the selectivity of tadalafil binding to two closely related phosphodiesterases, PDE5 and PDE6.
22960860 2012 Evaluation of PDE5 and PDE9 expression in benign and malignant breast tumors.