Property Summary

Ligand Count 78
NCBI Gene PubMed Count 36
PubMed Score 77.46
PubTator Score 242.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 5.5e-03
breast carcinoma -1.200 6.5e-03
cutaneous lupus erythematosus 1.100 3.5e-03
ductal carcinoma in situ -2.400 1.5e-03
fibroadenoma -1.700 4.7e-02
interstitial cystitis 1.100 2.7e-04
intraductal papillary-mucinous adenoma (... -1.100 3.6e-02
invasive ductal carcinoma -2.500 6.5e-03
lung cancer -1.200 1.3e-03
lung carcinoma -1.900 2.8e-12
medulloblastoma 1.200 5.5e-03
medulloblastoma, large-cell 1.500 4.9e-05
non-small cell lung cancer -1.024 6.5e-19
osteosarcoma -1.940 1.2e-02
ovarian cancer -1.100 5.7e-09
pancreatic ductal adenocarcinoma liver m... -1.097 6.9e-03
tuberculosis -1.300 1.3e-03
ulcerative colitis -1.373 3.8e-03

Gene RIF (19)

AA Sequence

MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELRPPPASPQQPR      1 - 70
RCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLSPLFSIACAFFFLTCFLTRTK     71 - 140
RGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGDAGSAAPHTPPEAAAGRLLLVLSCVGLLLTL    141 - 210
AHPLRLRHCVLVLLLASFVWWVSFTSLGSLPSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSS    211 - 280
AAEEKVPVIRPRRRSSCVSLGETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNG    281 - 350
VDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG    351 - 420
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPK    421 - 490
QRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPN    491 - 560
TPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDS    561 - 630
RKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVM    631 - 700
YTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTG    701 - 770
NETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ    771 - 840
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKAN    841 - 910
DVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRS    911 - 980
SPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPR    981 - 1050
RKSRRRIFCQLMHHLTENHKIWKEIVEEEEKCKADGNKLQVENSSLPQADEIQVIEEADEEE           1051 - 1112
//

Text Mined References (42)

PMID Year Title