Property Summary

NCBI Gene PubMed Count 36
PubMed Score 75.55
PubTator Score 242.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 3.5e-03
osteosarcoma -1.940 1.2e-02
atypical teratoid / rhabdoid tumor -1.300 5.5e-03
sonic hedgehog group medulloblastoma 1.700 7.9e-04
medulloblastoma, large-cell 1.500 4.9e-05
ulcerative colitis -1.373 3.8e-03
tuberculosis -1.500 6.9e-04
pancreatic ductal adenocarcinoma liver m... -1.097 6.9e-03
non-small cell lung carcinoma -1.100 1.0e-19
intraductal papillary-mucinous adenoma (... -1.100 3.6e-02
lung cancer -1.200 1.3e-03
breast carcinoma -1.200 6.5e-03
fibroadenoma -1.700 4.7e-02
interstitial cystitis 1.100 2.7e-04
lung carcinoma -1.900 2.8e-12
ductal carcinoma in situ -3.200 1.4e-03
invasive ductal carcinoma -3.600 3.9e-03
ovarian cancer -1.100 5.7e-09

Gene RIF (19)

PMID Text
26283042 Our results shed more light on phosphodiesterase 3A activation and could be relevant to the treatment of severe hypertension in the general population.
25208829 Data indicate that genome-wide significant associations were found both at age 6 and 14 with single nucleotide polymorphisms (SNPs) on chromosome 11p15 in phosphodiesterase 3B, cGMP-inhibited protein PDE3B/cytochrome P-450 CYP2R1 genes.
22001403 PDE3B appears to be an important actor in regulation of energy metabolism and energy intake. Is inhibition of PDE3B a possible target for treatment of obesity or type 2 diabetes mellitus? [REVIEW]
21963837 Rescue of low O(2)-induced ATP release from erythrocytes of type 2 diabetics by cilostazol restored the ability of erythrocytes to participate in the regulation of perfusion distribution in skeletal muscle.
21724851 PDE3B and the anti-lipolytic action of insulin may have a role in increased S-nitrosylation of adipose tissue in obesity
21393242 PDE3B and EPAC1 bind directly through protein-protein interactions
21152070 PDE3B is activated in response to agents relevant for beta-cell function and activation is linked to increased as well as decreased phosphorylation of the enzyme
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19569180 Data suggest that five novel genes, LUM, PDE3B, PDGF-C, NRG1 and PKD2, have great potential for predicting the efficacy of cisplatin-based chemotherapy against OSCC.
18586889 Findings demonstrate that PDE3B is present in human erythrocytes and are consistent with the hypothesis that PDE3 activity regulates cAMP levels associated with a signaling pathway activated by iloprost in these cells.
17884339 Cells can contain several non-overlapping PKA- and EPAC-based signaling complexes that allow PDE4D/PDE3B coordination of cell adhesion.
17255105 Selective interaction between activated phosphodiesterase 3B and 14-3-3 proteins represents a mechanism by which cells can protect this enzyme from deactivation.
16476736 p87PIKAP is a novel regulatory subunit of phosphoinositide 3-kinase gamma that is highly expressed in heart and interacts with PDE3B [p87PIKAP]
15147193 Results explain the dual cyclic AMP/cyclic GMP binding capabilities of phosphodiesterase 3B and provide the molecular basis for inhibitor specificity.
12765845 Observational study of gene-disease association. (HuGE Navigator)
11839681 Inhibition of PDE3B augments PDE4 inhibitor-induced apoptosis in a subset of patients with chronic lymphocytic leukemia
11640991 Observational study of gene-disease association. (HuGE Navigator)
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELRPPPASPQQPR      1 - 70
RCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLSPLFSIACAFFFLTCFLTRTK     71 - 140
RGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGDAGSAAPHTPPEAAAGRLLLVLSCVGLLLTL    141 - 210
AHPLRLRHCVLVLLLASFVWWVSFTSLGSLPSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSS    211 - 280
AAEEKVPVIRPRRRSSCVSLGETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNG    281 - 350
VDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG    351 - 420
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPK    421 - 490
QRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPN    491 - 560
TPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDS    561 - 630
RKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVM    631 - 700
YTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTG    701 - 770
NETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ    771 - 840
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKAN    841 - 910
DVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISPFMDRS    911 - 980
SPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPR    981 - 1050
RKSRRRIFCQLMHHLTENHKIWKEIVEEEEKCKADGNKLQVENSSLPQADEIQVIEEADEEE           1051 - 1112
//

Text Mined References (42)

PMID Year Title
26283042 2015 Clinical effects of phosphodiesterase 3A mutations in inherited hypertension with brachydactyly.
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22479202 2012 Novel loci for adiponectin levels and their influence on type 2 diabetes and metabolic traits: a multi-ethnic meta-analysis of 45,891 individuals.
22001403 2011 From PDE3B to the regulation of energy homeostasis.
21963837 2011 A selective phosphodiesterase 3 inhibitor rescues low PO2-induced ATP release from erythrocytes of humans with type 2 diabetes: implication for vascular control.
21724851 2011 Increased adipocyte S-nitrosylation targets anti-lipolytic action of insulin: relevance to adipose tissue dysfunction in obesity.
21393242 2011 A phosphodiesterase 3B-based signaling complex integrates exchange protein activated by cAMP 1 and phosphatidylinositol 3-kinase signals in human arterial endothelial cells.
21152070 2010 Expression and regulation of cyclic nucleotide phosphodiesterases in human and rat pancreatic islets.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19569180 2010 Identification of cisplatin-resistance related genes in head and neck squamous cell carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18586889 2008 Phosphodiesterase 3 is present in rabbit and human erythrocytes and its inhibition potentiates iloprost-induced increases in cAMP.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17884339 2007 Numerous distinct PKA-, or EPAC-based, signalling complexes allow selective phosphodiesterase 3 and phosphodiesterase 4 coordination of cell adhesion.
17255105 2007 Protein kinase A phosphorylation of human phosphodiesterase 3B promotes 14-3-3 protein binding and inhibits phosphatase-catalyzed inactivation.
16702214 2006 Importance of cAMP-response element-binding protein in regulation of expression of the murine cyclic nucleotide phosphodiesterase 3B (Pde3b) gene in differentiating 3T3-L1 preadipocytes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16476736 2006 Characterization of p87PIKAP, a novel regulatory subunit of phosphoinositide 3-kinase gamma that is highly expressed in heart and interacts with PDE3B.
16395595 2006 Human-specific nonsense mutations identified by genome sequence comparisons.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147193 2004 Crystal structure of human phosphodiesterase 3B: atomic basis for substrate and inhibitor specificity.
12765845 2003 Systematic search for single nucleotide polymorphisms in the 5' flanking region of the human phosphodiesterase 3B gene: absence of evidence for major effects of identified polymorphisms on susceptibility to Japanese type 2 diabetes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453887 2002 Identification of the insulin-regulated interaction of phosphodiesterase 3B with 14-3-3 beta protein.
11839681 2002 Inhibition of PDE3B augments PDE4 inhibitor-induced apoptosis in a subset of patients with chronic lymphocytic leukemia.
11641262 2001 Mechanism of intracellular calcium ([Ca2+]i) inhibition of lipolysis in human adipocytes.
11640991 2001 Analysis of the insulin-sensitive phosphodiesterase 3B gene in type 2 diabetes.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
10952971 2000 Membrane localization of cyclic nucleotide phosphodiesterase 3 (PDE3). Two N-terminal domains are required for the efficient targeting to, and association of, PDE3 with endoplasmic reticulum.
10454575 1999 Insulin-induced phosphorylation and activation of cyclic nucleotide phosphodiesterase 3B by the serine-threonine kinase Akt.
9102399 1997 Structure, localization, and regulation of cGMP-inhibited phosphodiesterase (PDE3).
8921398 1996 Molecular cloning and chromosomal assignment of the human homologue of the rat cGMP-inhibited phosphodiesterase 1 (PDE3A)--a gene involved in fat metabolism located at 11p 15.1.
8884271 1996 Characterization of the cDNA and gene encoding human PDE3B, the cGIP1 isoform of the human cyclic GMP-inhibited cyclic nucleotide phosphodiesterase family.
8706823 1996 Differential expression of cGMP-inhibited cyclic nucleotide phosphodiesterases in human hepatoma cell lines.
8626720 1996 Identification of the site in the cGMP-inhibited phosphodiesterase phosphorylated in adipocytes in response to insulin and isoproterenol.
8562305 1995 Type III cGMP-inhibited cyclic nucleotide phosphodiesterases (PDE3 gene family).
8557689 1996 Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases.
8163498 1994 Identification of the phosphorylation site in vitro for cAMP-dependent protein kinase on the rat adipocyte cGMP-inhibited cAMP phosphodiesterase.