Property Summary

Ligand Count 32
NCBI Gene PubMed Count 21
PubMed Score 24.67
PubTator Score 21.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.200 1.0e-02
astrocytic glioma -1.600 3.5e-02
atypical teratoid / rhabdoid tumor -3.200 1.6e-06
Breast cancer -2.400 8.0e-59
breast carcinoma -1.400 3.8e-27
cystic fibrosis -1.451 5.1e-04
ductal carcinoma in situ -1.200 1.5e-02
ependymoma -2.600 1.0e-02
glioblastoma -1.400 2.4e-03
group 4 medulloblastoma 1.500 8.2e-04
interstitial cystitis 1.100 1.3e-02
invasive ductal carcinoma -1.500 2.0e-02
lung adenocarcinoma -1.500 8.9e-15
malignant mesothelioma 1.500 4.1e-05
medulloblastoma, large-cell -2.700 2.6e-04
non-small cell lung carcinoma -1.600 7.9e-30
oligodendroglioma -1.600 4.5e-02
osteosarcoma -1.867 2.3e-02
Pick disease -1.100 5.1e-03
primitive neuroectodermal tumor -1.400 3.1e-02
progressive supranuclear palsy -1.400 7.0e-03

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVDLKKNLEYAAT      1 - 70
VLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFV     71 - 140
ERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALV    141 - 210
SFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFH    211 - 280
IQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIK    281 - 350
AMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS    351 - 420
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEG    421 - 490
SAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKARLAAEEQQKEMEAKSQAEEGA    491 - 560
SGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGKNKTDKKDHSNIGNDSKKTD    561 - 630
GTKQRSHGSPAPSTSSTCRLTLPVIKPPLRHFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQ    631 - 700
NISHNWNRK                                                                 701 - 709
//

Text Mined References (22)

PMID Year Title