Property Summary

NCBI Gene PubMed Count 21
PubMed Score 23.73
PubTator Score 21.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.500 4.1e-05
astrocytic glioma -2.800 3.5e-03
ependymoma -2.600 1.0e-02
oligodendroglioma -2.500 1.0e-02
glioblastoma -1.900 3.8e-03
osteosarcoma -1.867 2.3e-02
cystic fibrosis -1.775 9.6e-06
atypical teratoid / rhabdoid tumor -3.200 1.6e-06
medulloblastoma, large-cell -2.700 2.6e-04
primitive neuroectodermal tumor -2.900 4.1e-04
interstitial cystitis 1.100 1.3e-02
lung adenocarcinoma -1.500 8.9e-15
pediatric high grade glioma -1.800 6.6e-04
group 4 medulloblastoma 1.700 2.7e-05
non-small cell lung carcinoma -1.600 7.9e-30
breast carcinoma -1.400 3.8e-27
Pick disease -1.300 3.2e-02
progressive supranuclear palsy -1.400 7.0e-03
Breast cancer -2.900 2.5e-51
ductal carcinoma in situ -1.200 1.5e-02
invasive ductal carcinoma -1.500 2.0e-02

 MGI Phenotype (1)

Protein-protein Interaction (13)

Gene RIF (8)

PMID Text
25620587 PDE1C is a proliferation-associated gene in glioblastoma multiforme cells in vitro.
25608528 PDE1C is an important regulator of SMC proliferation, migration, and neointimal hyperplasia, in part through modulating endosome/lysosome-dependent PDGFRbeta protein degradation via low-density lipoprotein receptor-related protein-1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20110084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17726023 PDE1C1 is expressed at high levels in human cardiac myocytes with an intracellular distribution distinct from that of PDE3A
16455054 PDE1C levels decreased in all conditions that inhibited proliferation
11156964 HIV-1 Tat decreases the intracellular levels of cAMP and CREB ser-133 phosphorylation through a signal transduction pathway involving sequential activation of phosphatidylinositol 3-kinase, AKT, and cyclic nucleoside phosphodiesterases

AA Sequence

MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVDLKKNLEYAAT      1 - 70
VLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRRSDEKPRFKSIVHAVQAGIFV     71 - 140
ERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEASGDHALKFIFYELLTRYDLISRFKIPISALV    141 - 210
SFVEALEVGYSKHKNPYHNLMHAADVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFH    211 - 280
IQTRSDPAILYNDRSVLENHHLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIK    281 - 350
AMKTALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS    351 - 420
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKRSGVKTSGSEG    421 - 490
SAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKARLAAEEQQKEMEAKSQAEEGA    491 - 560
SGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGEQQQNGDFKDGKNKTDKKDHSNIGNDSKKTD    561 - 630
GTKQRSHGSPAPSTSSTCRLTLPVIKPPLRHFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQ    631 - 700
NISHNWNRK                                                                 701 - 709
//

Text Mined References (22)

PMID Year Title
25620587 2016 Cyclic nucleotide phosphodiesterase-1C (PDE1C) drives cell proliferation, migration and invasion in glioblastoma multiforme cells in vitro.
25608528 2015 Role of cAMP-phosphodiesterase 1C signaling in regulating growth factor receptor stability, vascular smooth muscle cell growth, migration, and neointimal hyperplasia.
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20110084 2010 Failure to replicate genetic associations with antidepressant treatment response in duloxetine-treated patients.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18335582 2008 Kinetic properties of Ca2+/calmodulin-dependent phosphodiesterase isoforms dictate intracellular cAMP dynamics in response to elevation of cytosolic Ca2+.
17726023 2007 Cyclic nucleotide phosphodiesterase PDE1C1 in human cardiac myocytes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16455054 2006 Subcellular localization and regulation of type-1C and type-5 phosphodiesterases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11834707 2002 Cyclic nucleotide phosphodiesterase 1C promotes human arterial smooth muscle cell proliferation.
11369604 2001 Stage and cell-specific expression of calmodulin-dependent phosphodiesterases in mouse testis.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8557689 1996 Isolation and characterization of cDNAs corresponding to two human calcium, calmodulin-regulated, 3',5'-cyclic nucleotide phosphodiesterases.
1326532 1992 A polymerase chain reaction strategy to identify and clone cyclic nucleotide phosphodiesterase cDNAs. Molecular cloning of the cDNA encoding the 63-kDa calmodulin-dependent phosphodiesterase.