Property Summary

NCBI Gene PubMed Count 11
PubMed Score 55.71
PubTator Score 10.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Budd-Chiari syndrome 12 3.15 1.6

Expression

Gene RIF (7)

AA Sequence

MQDPNADTEWNDILRKKGILPPKESLKELEEEAEEEQRILQQSVVKTYEDMTLEELEDHEDEFNEEDERA      1 - 70
IEMYRRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARK     71 - 140
FPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEE    141 - 210
NPKKPIEDVLLSSVRRSVLMKRDSDSEGD                                             211 - 239
//

Text Mined References (18)

PMID Year Title