Property Summary

NCBI Gene PubMed Count 72
PubMed Score 112.72
PubTator Score 107.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2388 3.175 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.400 2.3e-03
medulloblastoma, large-cell -1.100 1.8e-03
ovarian cancer -1.800 2.0e-12
pediatric high grade glioma -1.100 2.5e-03
Pick disease -1.400 1.2e-04
posterior fossa group B ependymoma -1.100 1.3e-04

Gene RIF (53)

AA Sequence

MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAV      1 - 70
ENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY                    71 - 125
//

Text Mined References (85)

PMID Year Title