1. Home
  2. Targets
  3. nucleic acid binding
  4. RNA binding protein
  5. translation factor
  6. translation elongation factor
  7. Programmed cell death protein 4

Tchem Programmed cell death protein 4

Inhibits translation initiation and cap-dependent translation. May excert its function by hindering the interaction between EIF4A1 and EIF4G. Inhibits the helicase activity of EIF4A. Modulates the activation of JUN kinase. Down-regulates the expression of MAP4K1, thus inhibiting events important in driving invasion, namely, MAPK85 activation and consequent JUN-dependent transcription. May play a role in apoptosis. Tumor suppressor. Inhibits tumor promoter-induced neoplastic transformation. Binds RNA (By similarity).

This gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]

 Comments

Property Summary

NCBI Gene PubMed Count 182
PubMed Score 284.95
PubTator Score 271.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Neoplasm Invasiveness 127
Disease Target Count Z-score Confidence
Cancer 2346 4.723 2.4

Expression

  Differential Expression (18)

Disease log2 FC p
esophageal adenocarcinoma -1.400 4.5e-02
psoriasis -2.000 3.9e-03
osteosarcoma -2.368 4.3e-05
posterior fossa group B ependymoma 1.500 9.0e-06
atypical teratoid/rhabdoid tumor 1.400 2.3e-04
adrenocortical carcinoma 1.667 1.3e-03
tuberculosis -1.700 2.2e-08
primary pancreatic ductal adenocarcinoma -1.518 1.3e-02
intraductal papillary-mucinous adenoma (... -1.200 7.4e-03
intraductal papillary-mucinous carcinoma... -2.200 1.5e-03
intraductal papillary-mucinous neoplasm ... -2.400 3.6e-03
colon cancer -1.500 3.1e-06
pancreatic cancer -1.800 1.7e-04
sonic hedgehog group medulloblastoma 1.300 8.9e-03
subependymal giant cell astrocytoma 1.226 3.7e-02
lung adenocarcinoma 1.138 1.1e-03
ulcerative colitis -2.500 4.8e-07
ovarian cancer -2.200 4.0e-06

Synonym

Accession Q53EL6 B2RCV4 B5ME91 O15501 Q5VZS6 Q6PJI5 Q8TAR5 Q99834
Symbols H731

Gene

PDCD4

PANTHER Protein Class (4)

PDB

2GGF   2KZT   2RG8   2ZU6   3EIJ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (14)

See all...

 GO Function (1)

 GO Component (4)

 GO Process (8)

 Compartment GO Term (24)

See all...

 MGI Phenotype (6)

 HCA RNA Cell Line (56)

See all...

Pathway (11)

See all...

Drug (1)

Structure of sirolimus

sirolimus
pEC50 7.30

Ligand (1)

Structure of CHEMBL267099

CHEMBL267099
pIC50 6.06

Gene RIF (161)

PMID Text
26961483 miR-183 maybe functions as an oncogene by regulating gastric cancer cell proliferation, apoptosis and metastasis and the oncogenic effect of miR-183 may relate the direct targeting PDCD4
26943153 PDGF-BB stimulates cell proliferation through microRNA-21-mediated PDCD4 down-regulation, leading to the development of TAO.
26871813 Results indicated that PDCD4 may be a novel candidate of tumor suppressor gene in hepatocellular carcinoma and that promoter hypermethylation is an important mechanism for its downregulation and a good predictor of survival.
26867589 This study describes the regulation of PDCD4 specifically in tonsil SCC by miR-499 and miR-21 and has documented the loss of PDCD4 in oropharyngeal squamous cell carcinoma
26802652 PDCD4 inhibits cell growth through PI3K/Akt signaling in non-small cell lung cancer.
26773498 We propose that SRSF3 could act as a coordinator of the expression of PDCD4 protein via two mechanisms on two alternatively spliced mRNA isoforms.
26367487 Dysregulation of miR-21 has an important role in tumor growth and invasion by targeting PDCD4.
26284486 miR-21 has a role in upregulating PTEN, RECK and PDCD4 in glioma
26276504 Low PDCD4 increases osteosarcoma cells resistance to apoptosis.
26252635 These findings support the feasibility of future efforts for diagnosis and gene therapy for prostate cancer that are based on IL-6, miR-21, and PDCD4.
26189797 Unprecedentedly, HuR was also found to bind to miR-21 directly, preventing its interaction with the PDCD4 3'-UTR, thereby preventing the translation repression of PDCD4.
26150475 These findings suggest that miR-21 and PDCD4 might be potential biomarkers for malignant melanoma and might provide treatment targets in the future.
26142886 PDCD4 is critical in mediating apoptosis in glioblastoma multiforme, and is downregulated by miR-21. (Review)
26063221 RT-qPCR and western blotting showed that miR-183 negatively regulated PDCD4 protein expression but had no impact on mRNA expression of PDCD4
26026468 of PDCD4 is down-regulated by HER2 signaling in AI-resistant breast cancer. Down-regulation of PDCD4 is associated with AI resistance and a poor prognosis in patients with ER-positive breast cancer.
25979949 we demonstrate that miR-21 regulates T-cell acute lymphoblastic leukemia cell survival via repression of the tumor suppressor Pdcd4.
25928036 proteomic screen for paclitaxel targets not only provided novel insight into the cellular resistance to paclitaxel via the PDCD4-mitotic exit regulation axis
25882842 CRL3(IBTK) is a novel ubiquitin ligase with regulatory roles in cellular pathways, such as the Pdcd4-dependent translation of mRNAs
25820028 This work describes a novel mechanism of translational suppression by Pdcd4 and shows for the first time that Hipk2 controls its own synthesis by an auto-regulatory feedback mechanism.
25776494 Decreased expression of PDCD4 mRNA by miR-183 overexpression in pancreatic cancer cells was linked to cell migration and invasion.
25573956 Activation of p70S6K1 that is inhibited by Pdcd4 is essential for resistance to the IGF-1R inhibitor in colon tumor cells.
25519906 PDCD4 mRNA is bound by the RNA-binding proteins HuR and TIA1, resulting in modulation of PDCD4 mRNA and protein levels.
25518924 Data suggest that miR-183 might play an oncogenic role in esophageal squamous cell carcinoma by regulating PDCD4 expression.
25316501 In medullary thyroid carcinoma miR-21 regulates PDCD4 expression and the miR-21/PDCD4 pathway correlates with clinicopathological variables and prognosis.
25310697 increasing expression of miR-21 with consequent downregulation of the tumour suppressor gene PDCD4.
25287716 modulation of the miR-150-PDCD4 axis shows promise as a therapeutic strategy for MIBC
25211657 Low expression of PDCD4 is associated with esophageal squamous cell carcinoma.
25190455 The study identifies poly(A)-binding protein as a novel functionally relevant Pdcd4 interaction partner that contributes to the regulation of translation by Pdcd4.
25175929 Results show that miR-21 was overexpressed in all tested head and neck squamous carcinoma cell lines, and regulated cellular proliferation possibly through downregulation of the tumor suppressor PDCD4.
25144746 Helicobacter pylori promotes epithelial-mesenchymal transition in gastric cancer by downregulating programmed cell death protein 4 (PDCD4).
25012722 The results of the present study demonstrated that overexpression of miR-182 may be involved in chemoresistance of non-small cell lung cancer cells to cisplatin by down-regulating PDCD4.
25002506 14-3-3 binding promotes PDCD4 degradation, suggesting an important role for RSK in the inactivation of PDCD4 in melanoma.
24982420 LPS promotes PDCD4 degradation via a pathway involving PI3K and mTOR, releasing Twist2, which induces IL-10 via c-Maf.
24902663 Data indicate that programmed cell death4 (PDCD4) is a target of microRNA-21 (miR-21).
24888238 PDCD4 and miR-21 are involved in OSC oncogenesis
24865582 Down-regulation of PDCD4 s associated with cisplatin resistance in ovarian cancer.
24786924 When compared to controls, patients with ankylosing spondylitis had significantly higher levels of miR-21, PDCD4 mRNA, and CTX. MiR-21 expression was negatively correlated with PDCD4 in patients with AS who were taking neither NSAID nor DMARD.
24778037 Our results help determine the significance of Pdcd4 loss in melanoma as well as its up-regulation by Akt pathway inhibitors
24764298 These findings suggest that the methylated form of PDCD4 promotes tumor viability during nutrient deprivation, ultimately allowing the tumor to grow more aggressively.
24659669 miR-21 is overexpressed in gastric cancer and its aberrant expression may have important role in gastric cancer growth and dissemination by modulating the expression of the tumor suppressors PTEN and PDCD4
24650454 MicroRNA-21 may play an oncogenic role by directly targeting PDCD4 in the cellular processes of papillary thyroid carcinoma.
24626527 atheroprotective unidirectional pulsatile shear stress affects the expression of PDCD4 in endothelial cells
24609942 Our data suggest that miR-21 could modulate chemosensitivity of TSCC cells to cisplatin by targeting PDCD4, and miR-21 may serve as a potential target for TSCC therapy
24568503 Low expression of PDCD4 protein is associated with drug resistance in advanced rectal cancer.
24413684 Loss of PDCD4 expression is associated with glioblastoma.
24334270 PDCD4 expression may be regulated at the transcription stage as well as at the post translation stage and the transcriptional regulation occurs through the PI3K-Akt-mTOR signaling pathway in hepatoma Huh7 cells
24334141 we described a novel molecular mechanism of Pdcd4 suppression in cancer cells consisting from mTOR signaling-dependent transcriptional repression of Pdcd4
24292556 Data suggest that the oncogenic potential of SRSF3 might be realized, in part, through the translational repression of PDCD4 mRNA.
24196965 the miR-21/PDCD4/AP-1 autoregulatory loop is one of the main driving forces for hepatic fibrosis progression.
24157866 PDCD4 as tumor suppressor regulated miR-184-mediated direct targeting of BCL2 and C-MYC.
24149370 miR-21 is a key player in oncogenic EMT, its overexpression is controlled by the cooperation of genetic and epigenetic alterations, and its levels, along with ITGbeta4 and PDCD4 expression, could be exploited as a prognostic tool for CRC metastasis.
24098127 during bacterial pneumonia IFNlambda promotes inflammation by inhibiting miR-21 regulation of PDCD4.
23904372 The expression of hMSH2 and PDCD4 in miR-21-inhibiting T98G cells.
23888942 we conclude that reactive oxygen species promotes gastric carcinogenesis via upregulating miR-21 expression which in turn downregulates the expression of PDCD4 in gastric cancer cells
23877371 Downregulation of microRNA-182 inhibits cell growth and invasion by targeting programmed cell death 4 in human lung adenocarcinoma cells.
23838800 Findings suggest that programmed cell death 4 (PDCD4) might be a potentially valuable molecular target in diagnosis and therapy for human digestive tract cancers.
23824073 Data indicate that berberine could inhibit miR-21 expression and function in ovarian cancer by an enhancement of its target PDCD4, an important tumor suppressor in ovarian cancer.
23606399 Results show that a variant MYB binding site in PDCD4 is associated to the severest form of childhood asthma suggesting that PDCD4 is a novel molecule of importance to asthmatic inflammatory responses.
23604124 this study reported for the first time that HBx downregulates PDCD4 and upregulates miR-21 expression
23578931 miR-21 plays a necessary role in cardiac valvulogenesis, in large part due to an obligatory downregulation of PDCD4
23564788 Loss of PDCD4 indicates chemoresistance in pancreatic cancer.
23486359 PDCD4 negatively regulates autophagy by targeting ATG5.
23469214 Feedback regulations of miR-21 and MAPKs via Pdcd4 and Spry1 are involved in arsenite-induced cell malignant transformation.
23441172 miR-21 promotes robust fibrogenic EMT of EMCs, in part by directly targeting PDCD4 and SPRY1.
23417858 Low PDCD4 is associated with tumorigenesis of liver fluke-associated cholangiocarcinoma.
23389919 PDCD4 expression might have an essential role in the progression of salivary adenoid cystic carcinoma.
23314309 The cumulative survival rate of gastric cancer patients with PDCD4 expression is significantly higher compared to the patients without PDCD4 expression.
23312883 Data indicate that programmed cell death 4 (Pdcd4) knockdown altered the adhesion capacity of colon carcinoma GEO cells.
23296900 PDCD4 Is Down-Regulated, Whereas miR-182 Is Up-Regulated in Ovarian Cancer
23224068 PDCD4 nuclear down-regulation (which parallels miR-21 up-regulation) is involved in the molecular pathway of inflammatory bowel disease-associated carcinogenesis.
23219426 Programmed cell death protein 4 (PDCD4) and Kruppel-like factor 6 (KLF6) were identified as critical regulators and surrogate markers of prostatic tissue architectures.
23212265 The present results provide evidence of PDCD4 having a role in thyroid carcino-genesis.
22986533 this study identifies a novel signaling mechanism mediated by FAT1 in regulating the activity of PDCD4 in gliomas.
22907752 The data indicated that hnRNPC controls the aggressiveness of glioblastoma cells through the regulation of PDCD4. Silencing of hnRNPC lowered miR-21 levels, in turn increasing the expression of PDCD4, suppressing Akt and p70S6K activation.
22801218 Pdcd4 knockdown up-regulates MAP kinase kinase kinase kinase 1 (MAP4K1) expression and increases phosphorylation of c-Jun.
22770403 microRNA-21 expression is up-regulated in human cholangiocarcinoma and PTEN, PDCD4 are direct effectors of microRNA-21.
22761399 The most significant discovery of the integrated validation is the down-regulation of FABP5 and PDCD4 in KRAS-activated human tumor bronchial epithelial cells.
22728051 Elevated leiomyoma miR-21 levels are predicted to decrease PDCD-4 levels, thus leiomyomas differ from other tumors where loss of PDCD-4 is associated with tumor progression.
22675936 PDCD4 may play an important role in occurrence and development of laryngeal squamous cell carcinomas through the inducing apoptosis and inhibiting proliferation.
22586265 IFN-dependent phosphorylation of PDCD4 results in downregulation of PDCD4 protein levels as the phosphorylated form of PDCD4 interacts with the ubiquitin ligase beta-TRCP (beta-transducin repeat-containing protein) and undergoes degradation.
22431522 PDCD4 as a specific repressor of the internal ribosome entry site-mediated translation of antiapoptotic proteins and is regulated by S6 kinase 2 dependent translation of cellular mRNAs (such as XIAP and Bcl-x(L)) that mediate FGF-2-S6K2 prosurvival signaling and provide further insight into the role of PDCD4 in tumor suppression
22419096 role of GSK3beta in Pdcd4 expression lung cancer cells
22359108 PDCD4 expression may play a key role in pre-cancerous lesions of human nasal inverted papillomas (NIPs) and may help predict malignant progression from benign nasal tumors to associated SCC.
22353043 These findings suggest that ursolic acid inhibits cell growth via causing apoptosis in U251 cells by a ursolic acid-triggered TGF-beta1/miR-21/PDCD4 pathway.
22335905 Suppression of tumor suppressor PDCD4 expression may be one of the important regulatory pathways of miR-21-mediated cell proliferation and decrease of apoptosis in non-small cell lung cancer.
22289349 This is the first study showing a direct impact of Pdcd4 on Ang-2 levels and, thereby, angiogenesis.
22272332 Data indicate that PDCD4 may play a critical function in arresting cell cycle progression at key checkpoint, thus inhibiting cell proliferation, as well as suppressing tumour metastasis.
22267128 PDCD4 mRNA levels were negatively regulated by miR-21in each tumor stage of colorectal cancer (CRC).
22213145 Ars2 is overexpressed in human cholangiocarcinoma and may be a diagnostic marker. Ars2 depletion increases PTEN and PDCD4 protein levels via the reduction of miR-21.
22212233 Data suggest that overexpression of miRNA-21 and reduced or loss of PDCD4 expression may play a role in the development and progression of gastric cancers.
22203471 PDCD4 is down-regulated in human RCC, which is correlated with biological aggressiveness and poor prognosis. As a tumor suppressor, PDCD4 probably plays an important role during the tumorigenesis of RCC.
22200873 PDCD4 utilizes TIMP-2 to exert its anti-invasive effect by suppressing leptin-induced activation of extracellular signal-regulated kinases 1,2 and signal transducer and activator of transcription 3.
22133680 These data support a decisive role for PDCD4 down regulation in transitional cell carcinoma and confirm miR-21 as a negative regulator for PDCD4.
22111549 ZBP-89 is a regulator of Pdcd4 gene, binding to the basal promoter either alone or by interacting with Sp family members.
22033922 Study demonstrates that Pdcd4 is directly involved in translational suppression of a natural mRNA with a 5'-structured UTR and provides novel insight into the translational control of p53 expression.
21983937 Overexpression of miRNA-21 is associated with the biological behavior of pancreatic ductal adenocarcinoma via the downregulation of PDCD4 and TIMP3, resulting in tumor progression and an adverse clinical course.
21959934 Loss of programmed cell death 4 induces apoptosis by promoting the translation of procaspase-3 mRNA.
21955614 Data show that 4-OHT reduced PDCD4 mRNA in MCF-7 cells consistent with the increase in miR-21 induced by 4-OHT.
21949999 The low expression of PDCD4 protein is closely related to the development and progression of laryngeal squamous cell carcinoma.
21934092 identified FOXO4 and PDCD4 as direct and functional targets of miR-499-5p
21894439 PDCD4 expression was correlated with beta-catenin expression in gastric carcinoma cell lines, but not with E-cadherin, as the binding partner in the cell membrane
21850542 these results suggest that downregulation of PDCD4 expression may have an essential role in the progression and malignant proliferation of human gastrointestinal stromal tumors
21809556 PD4 expression was elevated in laryngeal carcinoma, and might be closely related to mycoplasma infection.
21781452 Loss of heterozygosity contributes to tumor progression of oral squamous cell carcinoma, and a specific role for PDCD4, CTNNB1, and CASP4 was found.
21643008 c-myb mRNA as the first natural translational target mRNA of Pdcd4
21602271 Upregulated miR-21 affects PDCD4 expression and regulates aberrant T cell responses in human SLE.
21546206 this study demonstrates an inverse relationship between miR-21 and PDCD4. Which indicates that miR-21 post-transcriptionally downregulates PDCD4 by mRNA degradation through ginding to its target site with perfet complementarity.
21469387 PDCD4 gene is anti-oncogene that may play an important role in the pathogenesis and development of laryngeal carcinoma.
21454508 analysis of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G
21330826 Our analysis of Pdcd4 expression did not reveal any significant distinction between cancerous and normal endometrium.
21279518 miR-21 expression was significantly upregulated in preneoplastic/neoplastic colon samples, consistent with PDCD4 downregulation
21254647 The high expression of PD4, CD44 and PCNA proteins may be closely related to the pathogenesis, development and prognosis of laryngeal carcinoma.
20831814 Data show an association between the loss of PDCD4 expression, tumorigenesis and invasion in Oral Squamous Cell Carcinoma, and also identify a mechanism of PDCD4 down-regulation by microRNA-21 in oral carcinoma.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20735432 PDCD4 enhances cisplatin-induced apoptosis by mainly activating the death receptor pathway.
20702469 data support a significant role for PDCD4 downregulation in the progression of Barrett mucosa to Barrett carcinogenesis, and confirm miR-21 as a negative regulator of PDCD4 in vivo.
20656320 Therefore, programmed cell death 4 can be an important biomarker for intraductal papillary mucinous neoplasm.
20595005 PDCD4 plays an important role in mediating the sensitivity of gastric cancer cells to TRAIL-induced apoptosis through FLIP suppression.
20560677 PDCD4 regulates TRAIL sensitivity in gastric cancer cells by inhibiting the PI3K/Akt signaling pathway.
20514454 PDCD4 expression predicts the patient outcome in esophageal cancers.
20498644 The loss of Pdcd4 early in cancer progression may have an important role in the increased sensitivity of cancer cells to hypoxia through increased LOX activity and concomitant enhanced invasiveness.
20471435 Two isoforms of PKCs are involved in the regulation of the PDCD4 protein expression related to the proteasomal degradation pathway.
20372781 PDCD4 and microRNA-21 have a role in human gastric cancer
20359850 found that PDCD4 inhibits c-Jun amino-terminal kinase activity resulting in inhibition of the phosphorylation of c-Jun, one isoform of AP-1
19946272 miR-21 regulates PDCD4 expression after LPS stimulation.
19836969 Recent findings indicate that the microRNA miR-21 posttranscriptionally regulates Pdcd4, as well as invasion, intravasation, and metastasis of colon cancer.
19784072 Data show that elevated Snail expression by Pdcd4 knockdown leads to downregulation of E-cadherin resulting in activating beta-catenin/Tcf-dependent transcription.
19728867 Study demonstrated that the loss of Pdcd4 was a common abnormality at molecular level in ovarian cancer and it might be a potential prognostic factor in ovarian cancer patients.
19682430 miR-21 in HeLa cervical cancer cells caused profound suppression of cell proliferation, and up-regulated the expression of the tumor suppressor gene PDCD4.
19672202 Identified up-regulation of microRNA-21 (hsa-miR-21) concurrent with down-regulation of potent tumor suppressor proteins PTEN and programmed cell death 4 in cholesteatoma as compared with normal skin.
19641183 Reducing expression of miR-21 or miR-155 led to up-regulation of phosphatase and tensin homologue (PTEN), programmed cell death 4 (PDCD4), or Src homology-2 domain-containing inositol 5-phosphatase 1 (SHIP1).
19633292 Results indicate that HA binding to CD44 promotes PKCepsilon activation, increases the phosphorylation of the stem cell marker, Nanog, leads to microRNA-21 (miR-21) production and PDCD4 reduction.
19493270 PDCD4 inhibits the malignant phenotype of ovarian cancer cells.
19296468 Inhibitors of miR-21 increased levels of PDCD4 in cholangiocarcinoma.
19204291 reveals insights into the inhibition mechanism of eIF4A by PDCD4 and provides a framework for designing chemicals that target eIF4A
19153607 Structural and mutational analyses reveal that Pdcd4 inhibits translation initiation by trapping eIF4A in an inactive conformation, and blocking its incorporation into the eIF4F complex.
19031945 Lost or reduced PDCD4 expression is associated with the progression of ovarian serous cystadenocarcinomas and may serve as an important prognostic marker.
19013014 Inhibition of miR-21 increases endogenous levels of PDCD4 in cell line T98G and over-expression miR-21 inhibits PDCD4-dependent apoptosis
18793349 PDCD4 5'CpG island methylation blocks PDCD4 expression at mRNA levels in gliomas.
18549351 Suppression of Pdcd4 resulted in an increased release of CgA and Sg II and was accompanied by an up-regulation of intracellular PC1.
18476625 the pathogenesis, development and prognosis of laryngeal carcinoma maybe closely related to the high expression of PD4 and CD44v6, CD44v9 proteins.
18457901 in squamous cell carcinoma lung cancer lines, alterations in Pdcd4 mRNA and protein levels are not directly linked.
18427550 results provide the first evidence that Pdcd4 is important role in the DNA-damage response and suggest that low levels of Pdcd4 expression observed in certain tumor cells contribute to tumorigenesis by affecting the fate of DNA-damaged cells
18386173 Suppression of PDCD4 expression is associated with breast cancer cell invasion.
18372920 mir-21 functions as an oncogene by a mechanism that involves translational repression of the tumor suppressor Pdcd4
18296647 Pdcd4 is a translation inhibitor targeted for degradation during tumor promotion
18296639 the PDCD4 MA3 domains compete with the eIF4G MA3 domain and RNA for eIF4A binding. PDCD4 inhibits translation initiation by displacing eIF4G and RNA from eIF4A.
17991735 Programmed Cell Death 4 (PDCD4) is regulated by microrna miR-21 and demonstrate that PDCD4 is a functionally important target for miR-21 in breast cancer cells.
17982621 Altered cellular localization of PDCD4 when comparing normal breast to neoplastic breast tissue.
17955371 we conclude that the function of Pdcd4 might be cell type specific. A role for Pdcd4 in apoptosis or as a tumor suppressor might be limited to certain cell types.
17849461 Loss of programmed cell death 4 expression is associated with colorectal cancer
17828298 Downregulation of tumor suppressor Pdcd4 promotes colonic neoplastic transformation and tumor invasion
17297470 These data suggest Pdcd4 as a new negative regulator of intravasation, and qas the invasion-related gene u-PAR. It is the first study to implicate Pdcd4 regulation of gene expression via Sp1/Sp3.
17053147 in response to mitogens, PDCD4 was rapidly phosphorylated by protein kinase S6K1 & then degraded by ubiquitin ligase SCF(betaTRCP); it is proposed that regulated degradation of PDCD4 in response to mitogens allows efficient protein synthesis & cell growth
16682950 data suggest that PDCD4 is a proapoptotic molecule involved in TGF-beta1-induced apoptosis in human HCC cells, and a possible tumor suppressor in hepatocarcinogenesis
16449643 Pdcd4 suppresses tumor progression in colon carcinoma cells by the novel mechanism of down-regulating MAP4K1 transcription, with consequent inhibition of c-Jun activation and AP-1-dependent transcription.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15317660 expression of pdcd4 as an indirect suppressor of CDK1/cdc2 is lost in progressed carcinomas of lung, breast, colon, and prostate
15153438 overexpression of PDCD4 in carcinoid cells results in inhibition of cell proliferation.
15082783 Results indicate that not only binding to eIF4A but also prevention of eIF4A binding to the MA-3 domain of eIF4Gc contributes to the mechanism by which Pdcd4 inhibits translation.
12054647 up-regulated in senescent diploid fibroblasts

AA Sequence 

MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRD      1 - 70
SGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKD     71 - 140
PNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALE    141 - 210
GKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYID    211 - 280
SYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHC    281 - 350
LKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP    351 - 420
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY                         421 - 469
//

Text Mined References (192)

PMID Year Title
26961483 2016 MicroRNA-183 Functions As an Oncogene by Regulating PDCD4 in Gastric Cancer.
26943153 2016 PDGF-BB Enhances the Proliferation of Cells in Human Orbital Fibroblasts by Suppressing PDCD4 Expression Via Up-Regulation of microRNA-21.
26871813 2016 Hypermethylation and Expression Silencing of PDCD4 Gene in Hepatocellular Carcinoma: A Consort Study.
26867589 2016 Regulation of the tumour suppressor PDCD4 by miR-499 and miR-21 in oropharyngeal cancers.
26802652 2016 Reduced PDCD4 Expression Promotes Cell Growth Through PI3K/Akt Signaling in Non-Small Cell Lung Cancer.
26773498 2016 SRSF3 represses the expression of PDCD4 protein by coordinated regulation of alternative splicing, export and translation.
26367487 2015 miR-21 regulates tumor progression through the miR-21-PDCD4-Stat3 pathway in human salivary adenoid cystic carcinoma.
26284486 2015 Exosomal levels of miRNA-21 from cerebrospinal fluids associated with poor prognosis and tumor recurrence of glioma patients.
26276504 2016 TGF-?1-induced miR-202 mediates drug resistance by inhibiting apoptosis in human osteosarcoma.
26252635 2015 IL-6 Inhibits the Targeted Modulation of PDCD4 by miR-21 in Prostate Cancer.
26189797 2016 RNA-binding protein HuR sequesters microRNA-21 to prevent translation repression of proinflammatory tumor suppressor gene programmed cell death 4.
26150475 2015 Expression and clinicopathological significance of microRNA-21 and programmed cell death 4 in malignant melanoma.
26142886 2015 Targeting strategies on miRNA-21 and PDCD4 for glioblastoma.
26063221 2015 miR-183 regulates biological behavior in papillary thyroid carcinoma by targeting the programmed cell death 4.
26026468 2015 Down-regulation of programmed cell death 4 (PDCD4) is associated with aromatase inhibitor resistance and a poor prognosis in estrogen receptor-positive breast cancer.
25979949 2015 Dicer1 imparts essential survival cues in Notch-driven T-ALL via miR-21-mediated tumor suppressor Pdcd4 repression.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25928036 2015 Proteomic Profiling of Paclitaxel Treated Cells Identifies a Novel Mechanism of Drug Resistance Mediated by PDCD4.
25882842 2015 CRL3IBTK Regulates the Tumor Suppressor Pdcd4 through Ubiquitylation Coupled to Proteasomal Degradation.
25820028 2015 Programmed cell death 4 protein (Pdcd4) and homeodomain-interacting protein kinase 2 (Hipk2) antagonistically control translation of Hipk2 mRNA.
25776494 2015 miR-183 induces cell proliferation, migration, and invasion by regulating PDCD4 expression in the SW1990 pancreatic cancer cell line.
25573956 2015 Inhibition of p70S6K1 Activation by Pdcd4 Overcomes the Resistance to an IGF-1R/IR Inhibitor in Colon Carcinoma Cells.
25519906 2015 Post-transcriptional regulation of programmed cell death 4 (PDCD4) mRNA by the RNA-binding proteins human antigen R (HuR) and T-cell intracellular antigen 1 (TIA1).
25518924 2014 miRNA-183 suppresses apoptosis and promotes proliferation in esophageal cancer by targeting PDCD4.
25416956 2014 A proteome-scale map of the human interactome network.
25316501 2015 The PDCD4/miR-21 pathway in medullary thyroid carcinoma.
25310697 2014 Inflammation and MiR-21 pathways functionally interact to downregulate PDCD4 in colorectal cancer.
25287716 2014 miR-150 modulates cisplatin chemosensitivity and invasiveness of muscle-invasive bladder cancer cells via targeting PDCD4 in vitro.
25211657 2014 MicroRNA-183 promotes proliferation and invasion in oesophageal squamous cell carcinoma by targeting programmed cell death 4.
25190455 2014 An evolutionarily conserved interaction of tumor suppressor protein Pdcd4 with the poly(A)-binding protein contributes to translation suppression by Pdcd4.
25175929 2014 miR-21 increases the programmed cell death 4 gene-regulated cell proliferation in head and neck squamous carcinoma cell lines.
25144746 2014 Helicobacter pylori promotes epithelial-mesenchymal transition in gastric cancer by downregulating programmed cell death protein 4 (PDCD4).
25012722 2014 MicroRNA-182 modulates chemosensitivity of human non-small cell lung cancer to cisplatin by targeting PDCD4.
25002506 2014 Phosphoproteomic analysis identifies the tumor suppressor PDCD4 as a RSK substrate negatively regulated by 14-3-3.
24982420 2014 LPS induces the degradation of programmed cell death protein 4 (PDCD4) to release Twist2, activating c-Maf transcription to promote interleukin-10 production.
24902663 2014 MicroRNA-21 (miR-21) post-transcriptionally downregulates tumor suppressor PDCD4 and promotes cell transformation, proliferation, and metastasis in renal cell carcinoma.
24888238 2014 Programmed cell death 4 and microRNA 21 inverse expression is maintained in cells and exosomes from ovarian serous carcinoma effusions.
24865582 2014 Upregulation of miR-21 in cisplatin resistant ovarian cancer via JNK-1/c-Jun pathway.
24786924 2014 Higher expression of whole blood microRNA-21 in patients with ankylosing spondylitis associated with programmed cell death 4 mRNA expression and collagen cross-linked C-telopeptide concentration.
24778037 2014 Expression of Pdcd4 tumor suppressor in human melanoma cells.
24764298 2014 Enhanced arginine methylation of programmed cell death 4 protein during nutrient deprivation promotes tumor cell viability.
24732886 2014 Endothelial apoptosis in pulmonary hypertension is controlled by a microRNA/programmed cell death 4/caspase-3 axis.
24659669 MicroRNA-21 stimulates gastric cancer growth and invasion by inhibiting the tumor suppressor effects of programmed cell death protein 4 and phosphatase and tensin homolog.
24650454 2014 MicroRNA-21 regulates biological behaviors in papillary thyroid carcinoma by targeting programmed cell death 4.
24626527 2014 Atheroprotective pulsatile flow induces ubiquitin-proteasome-mediated degradation of programmed cell death 4 in endothelial cells.
24609942 2014 MiR-21 modulates chemosensitivity of tongue squamous cell carcinoma cells to cisplatin by targeting PDCD4.
24568503 2014 PDCD4 as a predictor of sensitivity to neoadjuvant chemoradiotherapy in locally advanced rectal cancer patients.
24413684 2014 Tumor suppressor PDCD4 inhibits NF-?B-dependent transcription in human glioblastoma cells by direct interaction with p65.
24334270 2014 Control of a tumor suppressor PDCD4: Degradation mechanisms of the protein in hepatocellular carcinoma cells.
24334141 2014 mTOR-dependent transcriptional repression of Pdcd4 tumor suppressor in lung cancer cells.
24292556 2014 Splicing factor SRSF3 represses the translation of programmed cell death 4 mRNA by associating with the 5'-UTR region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24196965 2013 The autoregulatory feedback loop of microRNA-21/programmed cell death protein 4/activation protein-1 (MiR-21/PDCD4/AP-1) as a driving force for hepatic fibrosis development.
24157866 2013 Tumor suppressor PDCD4 modulates miR-184-mediated direct suppression of C-MYC and BCL2 blocking cell growth and survival in nasopharyngeal carcinoma.
24149370 2014 Epigenetic regulation of miR-21 in colorectal cancer: ITGB4 as a novel miR-21 target and a three-gene network (miR-21-ITG?4-PDCD4) as predictor of metastatic tumor potential.
24098127 2013 Bacterial pathogens activate a common inflammatory pathway through IFN? regulation of PDCD4.
23904372 2013 MiR-21 mediates the radiation resistance of glioblastoma cells by regulating PDCD4 and hMSH2.
23888942 2014 Oxidative stress upregulates PDCD4 expression in patients with gastric cancer via miR-21.
23877371 2014 Downregulation of microRNA-182 inhibits cell growth and invasion by targeting programmed cell death 4 in human lung adenocarcinoma cells.
23838800 2013 Downregulation of programmed cell death 4 (PDCD4) in tumorigenesis and progression of human digestive tract cancers.
23824073 2013 Berberine sensitizes ovarian cancer cells to cisplatin through miR-21/PDCD4 axis.
23606399 2013 A polymorphism affecting MYB binding within the promoter of the PDCD4 gene is associated with severe asthma in children.
23604124 2013 HBx-mediated miR-21 upregulation represses tumor-suppressor function of PDCD4 in hepatocellular carcinoma.
23578931 2013 miR-21 represses Pdcd4 during cardiac valvulogenesis.
23564788 2013 Chemosensitivity induced by down-regulation of microRNA-21 in gemcitabine-resistant pancreatic cancer cells by indole-3-carbinol.
23486359 2013 Tumor suppressor gene PDCD4 negatively regulates autophagy by inhibiting the expression of autophagy-related gene ATG5.
23469214 2013 Feedback regulations of miR-21 and MAPKs via Pdcd4 and Spry1 are involved in arsenite-induced cell malignant transformation.
23441172 2013 miR-21 promotes fibrogenic epithelial-to-mesenchymal transition of epicardial mesothelial cells involving Programmed Cell Death 4 and Sprouty-1.
23417858 2013 Overexpression of microRNA-21 regulating PDCD4 during tumorigenesis of liver fluke-associated cholangiocarcinoma contributes to tumor growth and metastasis.
23389919 2013 Prognostic significance of PDCD4 expression in human salivary adenoid cystic carcinoma.
23314309 2013 PDCD4 functions as a suppressor for pT2a and pT2b stage gastric cancer.
23312883 2013 Down-regulation of programmed cell death 4 leads to epithelial to mesenchymal transition and promotes metastasis in mice.
23296900 2013 MicroRNA-182 promotes cell growth, invasion, and chemoresistance by targeting programmed cell death 4 (PDCD4) in human ovarian carcinomas.
23224068 2013 PDCD4/miR-21 dysregulation in inflammatory bowel disease-associated carcinogenesis.
23219426 2013 Molecular profiling of prostatic acinar morphogenesis identifies PDCD4 and KLF6 as tissue architecture-specific prognostic markers in prostate cancer.
23212265 2013 PDCD4 expression in thyroid neoplasia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22986533 2013 FAT1 acts as an upstream regulator of oncogenic and inflammatory pathways, via PDCD4, in glioma cells.
22907752 2012 Heterogeneous nuclear ribonucleoprotein C1/C2 controls the metastatic potential of glioblastoma by regulating PDCD4.
22801218 2012 Pdcd4 knockdown up-regulates MAP4K1 expression and activation of AP-1 dependent transcription through c-Myc.
22770403 2012 PTEN and PDCD4 are bona fide targets of microRNA-21 in human cholangiocarcinoma.
22761399 2012 Label-free quantitative proteomics and N-glycoproteomics analysis of KRAS-activated human bronchial epithelial cells.
22728051 2012 Role of microRNA-21 and programmed cell death 4 in the pathogenesis of human uterine leiomyomas.
22675936 2012 [Expression of programmed cell death 4 and its correlation with proliferation and apoptosis in laryngeal squamous cell carcinoma].
22586265 2012 Regulatory effects of programmed cell death 4 (PDCD4) protein in interferon (IFN)-stimulated gene expression and generation of type I IFN responses.
22431522 2012 Tumor suppressor PDCD4 represses internal ribosome entry site-mediated translation of antiapoptotic proteins and is regulated by S6 kinase 2.
22419096 Protein kinase GSK3? regulates tumor suppressor Pdcd4 expression in lung cancer cells.
22359108 2012 Clinical significance of programmed cell death 4 expression in malignant progression of human nasal inverted papillomas.
22353043 2012 Ursolic acid inhibits proliferation and induces apoptosis in human glioblastoma cell lines U251 by suppressing TGF-?1/miR-21/PDCD4 pathway.
22335905 2011 [Overexpression of miR-21 promotes proliferation and reduces apoptosis in non-small cell lung cancer].
22289349 2012 Knock-down of Pdcd4 stimulates angiogenesis via up-regulation of angiopoietin-2.
22272332 2012 Tumour suppressive function and modulation of programmed cell death 4 (PDCD4) in ovarian cancer.
22267128 2012 Prognostic significance of PDCD4 expression and association with microRNA-21 in each Dukes' stage of colorectal cancer patients.
22213145 2013 Ars2 is overexpressed in human cholangiocarcinomas and its depletion increases PTEN and PDCD4 by decreasing microRNA-21.
22212233 2012 PDCD4 expression inversely correlated with miR-21 levels in gastric cancers.
22203471 2012 Down-regulation of PDCD4 expression is an independent predictor of poor prognosis in human renal cell carcinoma patients.
22200873 2012 Programmed cell death 4 inhibits leptin-induced breast cancer cell invasion.
22133680 2012 Expression of programmed cell death protein 4 (PDCD4) and miR-21 in urothelial carcinoma.
22111549 2012 Promoter cloning and characterization of the human programmed cell death protein 4 (pdcd4) gene: evidence for ZBP-89 and Sp-binding motifs as essential Pdcd4 regulators.
22033922 2011 Tumor suppressor protein Pdcd4 inhibits translation of p53 mRNA.
21983937 2012 Association of microRNA-21 expression with its targets, PDCD4 and TIMP3, in pancreatic ductal adenocarcinoma.
21959934 2012 Loss of programmed cell death 4 induces apoptosis by promoting the translation of procaspase-3 mRNA.
21955614 2011 Differential expression of microRNA expression in tamoxifen-sensitive MCF-7 versus tamoxifen-resistant LY2 human breast cancer cells.
21949999 2011 [Expression of programmed cell death 4 protein is closely correlated with laryngeal squamous cell carcinomas].
21934092 2011 MicroRNA-499-5p promotes cellular invasion and tumor metastasis in colorectal cancer by targeting FOXO4 and PDCD4.
21894439 2011 Expression patterns of the tumor suppressor PDCD4 and correlation with ?-catenin expression in gastric cancers.
21850542 2012 An essential role of PDCD4 in progression and malignant proliferation of gastrointestinal stromal tumors.
21809556 2011 [The expression of PD4 and its significance in human laryngeal carcinoma].
21781452 LOH at PDCD4, CTNNB1, and CASP4 loci contributes to stage progression of oral cancer.
21643008 2011 Pdcd4 directly binds the coding region of c-myb mRNA and suppresses its translation.
21602271 2011 Identification of novel microRNA signatures linked to human lupus disease activity and pathogenesis: miR-21 regulates aberrant T cell responses through regulation of PDCD4 expression.
21546206 2011 MicroRNA-21 and PDCD4 expression in colorectal cancer.
21469387 2011 [The expression and clinical pathological significance of PDCD in laryngocarcinoma].
21454508 2011 Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21330826 2011 Highly increased maspin expression corresponds with up-regulation of miR-21 in endometrial cancer: a preliminary report.
21279518 2011 PDCD4 nuclear loss inversely correlates with miR-21 levels in colon carcinogenesis.
21269460 2011 Initial characterization of the human central proteome.
21254647 2010 [Detection of PD4, CD44, PCNA protein and its clinical significance in human laryngeal carcinoma].
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
20831814 2010 Programmed cell death 4 loss increases tumor cell invasion and is regulated by miR-21 in oral squamous cell carcinoma.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20735432 2010 Programmed cell death 4 enhances chemosensitivity of ovarian cancer cells by activating death receptor pathway in vitro and in vivo.
20702469 2010 Programmed cell death 4 (PDCD4) expression during multistep Barrett's carcinogenesis.
20656320 2010 Pdcd4 expression in intraductal papillary mucinous neoplasm of the pancreas: its association with tumor progression and proliferation.
20595005 2010 Programmed cell death 4 (PDCD4) mediates the sensitivity of gastric cancer cells to TRAIL-induced apoptosis by down-regulation of FLIP expression.
20560677 2010 Programmed cell death 4 (PDCD4) enhances the sensitivity of gastric cancer cells to TRAIL-induced apoptosis by inhibiting the PI3K/Akt signaling pathway.
20533548 2011 Micro-RNA-21 regulates TGF-?-induced myofibroblast differentiation by targeting PDCD4 in tumor-stroma interaction.
20514454 2010 Programmed cell death 4 protein in esophageal cancer.
20498644 2010 Pdcd4 repression of lysyl oxidase inhibits hypoxia-induced breast cancer cell invasion.
20471435 2010 Regulation of tumor suppressor PDCD4 by novel protein kinase C isoforms.
20372781 2010 Clinicopathological and prognostic significance of PDCD4 and microRNA-21 in human gastric cancer.
20359850 2010 Interaction of Pdcd4 with eIF4E inhibits the metastatic potential of hepatocellular carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946272 2010 Negative regulation of TLR4 via targeting of the proinflammatory tumor suppressor PDCD4 by the microRNA miR-21.
19836969 2010 Pdcd4, a colon cancer prognostic that is regulated by a microRNA.
19784072 2010 Downregulation of E-cadherin is an essential event in activating beta-catenin/Tcf-dependent transcription and expression of its target genes in Pdcd4 knockdown cells.
19728867 2009 Loss of Programmed cell death 4 (Pdcd4) associates with the progression of ovarian cancer.
19682430 2009 MicroRNA-21 promotes cell proliferation and down-regulates the expression of programmed cell death 4 (PDCD4) in HeLa cervical carcinoma cells.
19672202 2009 Cholesteatoma growth and proliferation: posttranscriptional regulation by microRNA-21.
19641183 2009 Aberrant overexpression of microRNAs activate AKT signaling via down-regulation of tumor suppressors in natural killer-cell lymphoma/leukemia.
19633292 2009 Hyaluronan-CD44 interaction with protein kinase C(epsilon) promotes oncogenic signaling by the stem cell marker Nanog and the Production of microRNA-21, leading to down-regulation of the tumor suppressor protein PDCD4, anti-apoptosis, and chemotherapy resistance in breast tumor cells.
19493270 2009 PDCD4 inhibits the malignant phenotype of ovarian cancer cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19296468 2009 MicroRNA-21 is overexpressed in human cholangiocarcinoma and regulates programmed cell death 4 and tissue inhibitor of metalloproteinase 3.
19204291 2009 Crystal structure of the eIF4A-PDCD4 complex.
19153607 2009 Structural basis for translational inhibition by the tumour suppressor Pdcd4.
19031945 Expression and prognostic significance of PDCD4 in human epithelial ovarian carcinoma.
19013014 2008 MicroRNA-21 down-regulates the expression of tumor suppressor PDCD4 in human glioblastoma cell T98G.
18793349 2009 PDCD4 gene silencing in gliomas is associated with 5'CpG island methylation and unfavourable prognosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18549351 2008 Knockdown of Pdcd4 results in induction of proprotein convertase 1/3 and potent secretion of chromogranin A and secretogranin II in a neuroendocrine cell line.
18476625 2008 [Expression of PD4, CD44v6, CD44v9 and its clinical significance in human laryngeal carcinoma].
18457901 2008 Pdcd4 protein and mRNA level alterations do not correlate in human lung tumors.
18427550 2008 siRNA-mediated knockdown of Pdcd4 expression causes upregulation of p21(Waf1/Cip1) expression.
18386173 2009 Programmed cell death 4 inhibits breast cancer cell invasion by increasing tissue inhibitor of metalloproteinases-2 expression.
18372920 2008 MicroRNA-21 promotes cell transformation by targeting the programmed cell death 4 gene.
18296647 2008 Translation inhibitor Pdcd4 is targeted for degradation during tumor promotion.
18296639 2008 PDCD4 inhibits translation initiation by binding to eIF4A using both its MA3 domains.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17991735 2008 Programmed cell death 4 (PDCD4) is an important functional target of the microRNA miR-21 in breast cancer cells.
17982621 2007 Alterations in the expression of PDCD4 in ductal carcinoma of the breast.
17955371 2008 The action of Pdcd4 may be cell type specific: evidence that reduction of dUTPase levels might contribute to its tumor suppressor activity in Bon-1 cells.
17849461 2007 Loss of programmed cell death 4 expression marks adenoma-carcinoma transition, correlates inversely with phosphorylated protein kinase B, and is an independent prognostic factor in resected colorectal cancer.
17828298 2008 Downregulation of tumor suppressor Pdcd4 promotes invasion and activates both beta-catenin/Tcf and AP-1-dependent transcription in colon carcinoma cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17297470 2007 Tumor suppressor Pdcd4 inhibits invasion/intravasation and regulates urokinase receptor (u-PAR) gene expression via Sp-transcription factors.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17053147 2006 S6K1- and betaTRCP-mediated degradation of PDCD4 promotes protein translation and cell growth.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16682950 2006 Involvement of programmed cell death 4 in transforming growth factor-beta1-induced apoptosis in human hepatocellular carcinoma.
16449643 2006 Tumorigenesis suppressor Pdcd4 down-regulates mitogen-activated protein kinase kinase kinase kinase 1 expression to suppress colon carcinoma cell invasion.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16357133 2005 Akt phosphorylates and regulates Pdcd4 tumor suppressor protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15317660 2004 Programmed cell death protein 4 suppresses CDK1/cdc2 via induction of p21(Waf1/Cip1).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15153438 2004 Programmed cell death protein 4 (PDCD4) acts as a tumor suppressor in neuroendocrine tumor cells.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15082783 2004 A novel function of the MA-3 domains in transformation and translation suppressor Pdcd4 is essential for its binding to eukaryotic translation initiation factor 4A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12898601 2003 Loss of PDCD4 expression in human lung cancer correlates with tumour progression and prognosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054647 2002 Up-regulation of PDCD4 in senescent human diploid fibroblasts.
10640828 1999 Assignment of the programmed cell death 4 gene (PDCD4) to human chromosome band 10q24 by in situ hybridization.
10632927 1999 Novel human PDCD4 (H731) gene expressed in proliferative cells is expressed in the small duct epithelial cells of the breast as revealed by an anti-H731 antibody.
9759869 1998 Differential transcriptional regulation of CD161 and a novel gene, 197/15a, by IL-2, IL-15, and IL-12 in NK and T cells.
8543179 1995 Isolation of a novel mouse gene MA-3 that is induced upon programmed cell death.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.