Property Summary

NCBI Gene PubMed Count 25
PubMed Score 21.53
PubTator Score 160.18

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.480 3.6e-03
malignant mesothelioma 1.100 7.2e-06
osteosarcoma -2.012 9.8e-05
group 3 medulloblastoma 1.900 2.9e-04
tuberculosis 1.100 9.4e-06
lung cancer 2.000 1.5e-04
non primary Sjogren syndrome sicca 1.100 1.5e-02
ovarian cancer -1.400 8.6e-05

Pathway (1)

Gene RIF (11)

PMID Text
26617804 PDCD2 may play an important role in tumor suppression in osteosarcoma. These mechanisms might be related to immune response induced by CD4(+) and CD8(+) T cells.
25334010 Loss of PDCD2 expression could contribute to gastric cancer development and progression.
25111461 Low PDCD2 expression is associated with gastric cancer.
24381196 Expression of human PDCD2 fully rescues the Drosophila Zfrp8 phenotype, underlining the functional conservation of Zfrp8/PDCD2.
23760497 PDCD2 RNA expression in acute leukemia patients correlates with disease status and is a significant predictor of clinical relapse.
22922207 PDCD2 has a novel regulatory role in human hematopoiesis and is essential for erythroid development.
20605493 Transfection of a construct expressing PDCD2 induces apoptosis in human cell lines through activation of the caspase cascade.
19146857 parkin interacts with programmed cell death-2 isoform 1 (PDCD2-1)
17468402 repression of PDCD2 by BCL6 is likely important in the pathogenesis of certain human lymphomas
16311922 To study the role of PDCD2_C domain in apoptosis, the cDNAs of two isoforms of PDCD2 and MGC13096 were cloned. PDCD2 (NM_002598) was over expressed when endothelial cells treated with leukotriene D4 or natural killer cells were activated by IL-2.
15848047 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSFLLQVYAPLPG      1 - 70
RPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGAHLCRVCGC     71 - 140
LGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDHIIPDHNFLFPEFEIVIETEDEIMPEVVEKE    141 - 210
DYSEIIGSMGEALEEELDSMAKHESREDKIFQKFKTQIALEPEQILRYGRGIAPIWISGENIPQEKDIPD    211 - 280
CPCGAKRILEFQVMPQLLNYLKADRLGKSIDWGILAVFTCAESCSLGTGYTEEFVWKQDVTDTP          281 - 344
//

Text Mined References (26)

PMID Year Title
26617804 2015 Programmed cell death 2 functions as a tumor suppressor in osteosarcoma.
25334010 2015 Programmed cell death 2 protein induces gastric cancer cell growth arrest at the early S phase of the cell cycle and apoptosis in a p53-dependent manner.
25111461 2014 miR-129-1-3p promote BGC-823 cell proliferation by targeting PDCD2.
24381196 2014 Zfrp8/PDCD2 is required in ovarian stem cells and interacts with the piRNA pathway machinery.
23760497 2013 PDCD2 functions in cancer cell proliferation and predicts relapsed leukemia.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
22922207 2012 PDCD2 knockdown inhibits erythroid but not megakaryocytic lineage differentiation of human hematopoietic stem/progenitor cells.
21269460 2011 Initial characterization of the human central proteome.
20605493 2010 PDCD2, a protein whose expression is repressed by BCL6, induces apoptosis in human cells by activation of the caspase cascade.
19958059 2009 Short hairpin RNA targeting beta-catenin suppresses cell proliferation and induces apoptosis in human gastric carcinoma cells.
19955554 2010 Microbial infections in eight genomic subtypes of chronic fatigue syndrome/myalgic encephalomyelitis.
19146857 2009 Programmed cell death-2 isoform1 is ubiquitinated by parkin and increased in the substantia nigra of patients with autosomal recessive Parkinson's disease.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18486760 Overexpression of the PDCD2-like gene results in inhibited TNF-alpha production in activated Daudi cells.
17468402 2007 Repression of the PDCD2 gene by BCL6 and the implications for the pathogenesis of human B and T cell lymphomas.
16311922 2005 Cloning of cDNAs with PDCD2(C) domain and their expressions during apoptosis of HEK293T cells.
15848047 2005 Evaluation of IDDM8 susceptibility locus in a Russian simplex family data set.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12149646 2002 PDCD2 is a negative regulator of HCF-1 (C1).
11854457 2002 The human programmed cell death-2 (PDCD2) gene is a target of BCL6 repression: implications for a role of BCL6 in the down-regulation of apoptosis.
7606924 1995 Isolation and mapping of a human gene (PDCD2) that is highly homologous to Rp8, a rat gene associated with programmed cell death.