Property Summary

NCBI Gene PubMed Count 348
PubMed Score 1328.41
PubTator Score 891.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Protein-protein Interaction (2)

Gene RIF (336)

PMID Text
27015087 Three polymorphisms in the 3' UTR region of LDLR, c.*52G>A, c.*504G>A, and c.*773A>G, and two at the 5' UTR region of PCSK9, c.-3383C>G and c.-2063A>G, were associated with response to Armolipid Plus
26896437 Serum PCSK9 concentration is associated with future risk of cardiovascular disease even after adjustments for established risk factors.
26833058 Polydatin ameliorates lipid and glucose metabolism in type 2 diabetes mellitus by downregulating PCSK9
26824363 Data show that leptin replacement decreased proprotein convertase subtilisin/kexin type 9 (PCSK9) and improved lipid parameters in female lipodystrophic subject.
26820623 Thrombotic antiphospholipid antibody carriers showed significant association with PCSK9 gene, a regulator of LDLR plasma levels.
26691006 PCSK9 could serve as a novel molecular biomarker for the non-invasive prenatal screening of neural tube defects.
26687699 Familial hypercholesterolemia individuals carry the PCSK9-InsLEU genetic variant benefit of lower risk of coronary events but show an increased occurrence of prediabetes and diabetes
26668321 Data suggest that PCSK9 is involved in regulation of lipid metabolism in hepatocytes by proinflammatory cytokine TNFalpha; induction of lipogenesis and insulin resistance in liver (as seen in obesity) involves up-regulation of both PCSK9 and SOCS3.
26666837 the current meta-analysis highlighted that variant allele of OLR1 rs11053646 G > C and PCSK9 rs505151 A > G may contribute to the susceptibility risk of ischemic stroke.
26632531 These data demonstrate that serum Lp(a) is elevated in patients with FH caused by PCSK9 gain-of-function mutations to the same level as that in FH caused by LDLR mutations.
26576960 PCSK9 E670G polymorphism was associated with coronary artery disease risk and blood lipid levels. (Meta-analysis)
26503748 The structure of PCSK9, gain or loss of function mutations, its effects on hepatic and intestinal lipid metabolism, and the more recently explored functions of PCSK9 in extrahepatic tissues are discussed. Review.
26494228 PCSK9-mediated CD36 degradation may serve to limit fatty acid uptake and triglyceride accumulation in tissues, such as the liver and adipose tissue.
26490048 study demonstrated that patients with differentiated thyroid cancer both before and after thyroid hormone withdrawal which is a hypothyroid phase, had increased proprotein convertase subtilisin/kexin type 9 levels and decreased ankle brachial index
26477595 Gain-of-function mutations in PCSK9 found to cause familial hypercholesterolemia, loss-of-function mutations amongst individuals with hypercholesterolemia accompanied by decreased risk of Coronary heart disease and death.
26455563 Alirocumab is a fully human monoclonal antibody that inhibits proprotein convertase subtilisin/kexin type 9.
26412029 Data suggest plasma levels of PCSK9 (proprotein convertase subtilisin/kexin type 9) and lipoprotein(a) are significantly up-regulated in patients with type 2 diabetes as compared to control subject; study was conducted in Tunisia.
26377225 High plasma PCSK9 levels are associated with type 2 diabetes.
26374825 PCSK9 GOF mutation carriers have elevated LDL-C levels and are at high risk of premature cardiovascular disease.
26371983 results suggested that the contribution of PCSK9 levels to the phenotypic severity in FH heterozygotes is independent of LDLR genotype
26350813 plasma apoB-to-PCSK9 ratio provides a better clinical index than PCSK9 alone for monitoring early metabolic disturbances that may be promoted by reduction in plasma PCSK9
26333678 PCSK9 directly increases atherosclerotic lesion inflammation
26195630 LDLR was not required for the degradation of CD81 by PCSK9, but its presence strengthened the PCSK9 effect.
26143741 No correlation between baseline levels of plasma PCSK9 and the fatty acid content of marine n-3 PUFA in adipose tissue.
26085104 We conclude that PCSK9 enhances the degradation of the LDLR independently of either APLP2 or sortilin both ex vivo and in mice.
26056005 A Fab fragment (designated PA4) bound with high affinity to PCSK9 was isolated after four rounds of panning. The fully human antibody IgG1-PA4 bound specifically to PCSK9 with nanomolar affinity
26049403 PCSK9 p.R46L LOF variant was not associated with impaired glucose homeostasis in humans
26048378 PCSK9 gene promotes the degradation of Low-density lipoprotein receptor and prevents it from recycling to the membrane.
26045785 PCSK9 may regulate apoptosis through mitochondrial pathway in human glioma cells.
26004275 Reviews the role of PCSK9 in low density lipoprotein metabolism and hyperlipidemia as well as its role as a therapeutic target.
25936324 Lipoprotein apheresis reduced PCSK9 levels in patients with hypercholesterolemia or hyperlipoproteinemia.
25913303 PCSK9 is required for supratranscriptional upregulation of LDLR by estradiol.
25911073 This article will describe and discuss PCSK9 interactive mechanisms and apply them to the interpretation of clinical trial results, which involve PCSK9 monoclonal antibodies.
25905719 Findings provide evidence that PCSK9 has at least two endocytic epitopes that are utilized by a variety of internalization mechanisms and clarifies how PCSK9 may direct proteins to lysosomes.
25899039 The combination of PCSK9 E670G and APOE polymorphisms may represent an independent factor for the determination of lipid levels.
25887680 PCSK9 affects cholesterol homeostasis via its action on extrahepatic organs. [Review]
25881720 Studies suggest that proprotein convertase subtilisin/kexin type 9 (PCSK9) may increase plasma low-density lipoprotein-cholesterol (LDL-C) levels.
25858546 Differences were found in circulating PCSK9 levels between men and women in the relationship of their major sex hormones.
25857271 Plant stanol esters provide an efficient dietary means to lower LDL-C without interfering with the PCSK9 metabolism.
25839937 Next generation sequencing results identify seven deleterious variants in LDLR, APOB and PCK9 genes highly associated with familial hypercholesterolemia.
25778403 LDLR plays a role in Lp(a) catabolism and that this process can be modulated by PCSK9
25770756 Plasma sdLDL-C was positively related to PCSK9 in patients with stable coronary artery disease, suggesting an interaction between sdLDL-C and PCSK9 in atherosclerotic coronary disease.
25744035 The human PCSK9 D374Y (gain of function) mutation causes severe hypercholesterolaemia due to a significantly decreased dissociation rate constant.
25665485 The difference in serum PCSK9 levels between postmenopausal and premenopausal woman appeared to be independent of estrogen status, and estrogen at physiological concentrations does not affect human hepatocyte PCSK9 expression.
25652089 HNF1alpha, but not HNF1beta, is the primary positive regulator of PCSK9 transcription in mouse liver
25496400 PCSK9 levels are independently associated with the changes of lipoprotein subfractions, suggesting a potential interaction between PCSK9 and lipoprotein subfractions in coronary artery disease.
25490141 PCSK9-reactive oxygen species interaction may be important in the development of atherosclerosis in arterial channels with low shear stress.
25466598 The ABO blood group might be a significant determinant factor for plasma PCSK9 level. It is also possible that the observed association between PCSK9 and ABO blood group might be in part involved in their CAD susceptibility.
25453988 Already a new and potent drug has been developed targeting PCSK9, which is in phase 3 clinical trials and shows great efficacy and safety for prevention of CAD.
25444750 PCSK9 is a key regulator in cholesterol metabolism.PCSK9 genetic variants and it's role in physiologic processes and pathological conditions.
25412415 Both rare and common variants in PCSK9 influence plasma LDL-C levels in American Indians.
25410128 provide an overview of the physiological role of PCSK9, which contributes to atherosclerosis, and provide data on PCSK9 as a novel pharmacological target
25341796 Stably express the pathological human D374Y gain-of-function mutant form of PCSK9 (PCSK9(DY)) in adult wild-type mice to generate a hyperlipidemic and proatherogenic animal model.
25320235 reduced PCSK9 function is associated with increased pathogen lipid clearance.
25278291 PCSK9 loss of function R46L missense variant was determined among a cohort of 582 familial hypercholesterolemia patients. This mutation is associated with a significantly lower risk of cardiovascular disease compared with noncarriers.
25266949 Both rs1711503 and rs2479408 of PCSK9 genes were associated with cerebral ischemic stroke in the Han population of China.
25258384 both LDLR and ApoE are required for PCSK9 inhibitor-mediated reductions in atherosclerosis
25239117 Results show the existence of the L8 allele of the PCSK9 rs72555377 polymorphism and multiple regression analysis showed that the L10 allele was significantly associated with a reduced risk of coronary artery disease and with its reduced severity.
25234562 the circulating PCSK9 concentration was positively associated with fibrinogen in patients with stable coronary artery disease
25222343 Ectodomain cleavage of an LDLR with bound PCSK9 in the sorting endosome disrupts the normal recycling of the LDLR [review]
25210046 the PCSK9 active site and its adjacent residues serve as an allosteric modulator of protein secretion independent of its role in proteolysis
25180781 Plasma PCSK9 levels are increased with acute myocardial infarction.
25172631 Thyroid hormone reduces PCSK9 and stimulates bile acid synthesis in humans
25164566 Curcumin reduced the nuclear abundance of hepatocyte nuclear factor 1alpha, resulting in its attenuated interaction with the PCSK9 promoter and leading to a downregulation of PCSK9 expression.
25128757 Plasma PCSK9 levels are not associated with body fat distribution indices, modestly associated with markers of insulin resistance and LDL particle size and are slightly affected by a lifestyle modification program in abdominally obese men.
25110901 Further study of PCSK9 regulatory mechanisms may identify additional control points for pharmacological inhibition of PCSK9-mediated LDLR degradation.
25070550 PCSK9 markedly increases intestinal triglyceride-rich apoB production through mechanisms mediated in part by transcriptional effects on apoB.
25062564 In a patient with a mutation in PCSK9 and thus no detectable plasma PCSK9, there was still preserved adrenal function.
25014035 Familial hypercholesterolemia caused by PCSK9 g-o-f mutations is relatively common in Japan and causes a mild type of homo- and hetero-FH compared with FH caused by LDLR mutations.
24808179 data revealed a plausible new role of AnxA2 in the reduction of PCSK9 protein levels via a translational mechanism.
24801085 An association was found between plasma PCSK9 levels and the severity of coronary stenosis in atherosclerosis patients.
24793346 genetic polymorphism contributes to the variability on plasma LDL cholesterol levels in hypercholesterolemic subjects in Brazil
24769476 Plasma PCSK9 levels are independently associated with white blood cell count and its subsets, suggesting a potential interaction between PCSK9 and chronic inflammation in patients with coronary artery disease.
24721682 PON-1 activity is more closely related to the HDL particle concentration or large HDL particles than to HDL cholesterol. Impaired PON-1 activity in T2DM is not to a considerable extent explained by altered HDL subfraction levels
24685817 The association of PCSK9 levels with CV events was reduced after adjustment for fasting TG.
24659111 The results indicate that regulation of PCSK9 in human CSF may be different than for plasma PCSK9, suggesting that further study of the role of PCSK9 in the CNS is warranted.
24632287 Elevated plasma PCSK9 level is equally detrimental for patients with nonfamilial hypercholesterolemia and heterozygous familial hypercholesterolemia, irrespective of low-density lipoprotein receptor defects
24625727 PCSK9 binds the hepatocyte LDL receptor, preventing its recycling and enhancing its degradation, resulting in reduced LDL-cholesterol clearance. It enhances the intracellular degradation of all its target proteins. Review.
24599757 E670G polymorphism of the PCSK9 gene is mainly associated with a increased risk and severity of CAD and IS in Tunisian cohort.
24529132 PCSK9 plays a significant role as a determining factor on LDL-C levels in chronic kidney disease hemodialysis patients
24518357 we mainly review recent data with regard to the association between PCSK9 genetic variants and plasma LDL-C concentrations--{REVIEW}
24486405 It was demonstrated that having excess levels of PCSK9 was not sufficient to determine the number of PCSK9/LDL receptor complexes that were formed within hepatocyte-like C3A cells.
24315769 hypercholesterolemia and elevation of plasma LDL cholesterol levels in patients with nephrotic syndrome and peritoneal dialysis patients are associated with increased plasma PCSK9 levels.
24308640 Plasma PCSK9 levels were strongly associated with plasma triacylglycerols and cholesterol levels in homozygous carriers of ApoE2.
24296664 PCSK9 trafficking in SV-589 human skin fibroblasts
24225950 Data indicate that Pep2-8 inhibited LDL receptor binding to PCSK9 with IC50 values of 0.8 mum.
24144304 The binding of WT-Ectodomain-LDLR to pro-PCSK9 in the endoplasmic reticulum (ER) promotes autocatalytic cleavage of PCSK9, and autocatalytically cleaved PCSK9 acts as a chaperone to promote the exit of WT-Ectodomain-LDLR from the ER.
24134510 PCSK9 and resistin are novel protein mediators of atherogenic dyslipidemia; Both PCSK9 and resistin act in large part by targeting and reducing the hepatic degradation of very-low-density lipoprotein apoB
24122718 Modulation of LDL cholesterol levels by lipoprotein apheresis reduces PCSK9 levels, an additional benefit for hypercholesteremia patients.
24103783 EGF-A of the LDLR is critical for PCSK9 binding at the cell surface
23925411 This review briefly summarizes the biochemistry and function of PCSK9 and the results from recent phase II trials. [review]
23817198 The discovery of PCSK9 as a secreted inhibitor of the LDL receptor. [Review]
23775089 Studies indicate that PCSK9 is the key player in cholesterol homeostasis.
23743349 Subjects with the apoE3/E2 genotype and PCSK9 R46L have increased plasma insulin, homeostasis model assessment of insulin resistance, and leptin, an intriguing finding that warrants further investigation.
23675525 While PCSK9 is capable of inducing degradation of LRP-1, the latter is not an essential factor for LDLR regulation, but the LDLR effectively competes with LRP-1 for PCSK9 activity.
23669246 An familial hypercholesterolemia-causing mutation was found in 101 unrelated patients (LDLR = 54 different mutations, APOB p.(Arg3527Gln) = 10, PCSK9 p.(Asp374Tyr) = 0).
23663650 We showed that the L10A53V and I474V PCSK9 variants were significantly associated with lower LDLC levels in Caucasian Canadians but differed in their effect on serum PCSK9 concentrations
23623011 PCSK9 deficiency caused a decrease in several cholesteryl esters (CE) and short fatty acid chain containing sphingolipid species.
23593297 genetic polymorphisms in LDLR, APOB, PCSK9 in familial hypercholesterolemia
23559630 Transintestinal cholesterol excretion is operative in jejunal explants and is regulated by PCSK9/ABCB1/statins.
23553812 REVIEW: PCSK9 loss-of-function mutations can have up to an 88% reduction in coronary heart disease without any deficits in neurologic or physiologic functions
23537802 PCSK9 levels are elevated in untreated familial hypercholesterolemia (FH) patients, particularly in those with homozygous FH (HoFH). High-dose statin therapy further increases PCSK9.
23535506 Novel mutations in the LDLR and PCSK9 genes have been identified in the Pakistani patients with familial hypercholesterolemia.
23509406 PCSK9-mediated degradation of the LDL receptor generates a 17 kDa C-terminal LDL receptor fragment.
23499248 we hypothesize that PCSK9 might increase oxidized LDL uptake and impair macrophage-mediated reverse cholesterol transport
23466067 Inhibition of the interaction between PCSK9 and the LDLR with mAbs targeting PCSK9 has great potential for patients with hypercholesterolaemia.
23450051 Plasma PCSK9 appears as a late biomarker of illness severity in patients with severe multiple trauma.
23430252 amyloid precursor protein-like protein-2, but not amyloid precursor protein, is involved in mediating postendocytic delivery of PCSK9 to lysosomes and is therefore important for PCSK9 function
23422832 in addition to its effect on LDLr, PCSK9 modulates cholesterol transport and metabolism, as well as production of apo B-containing lipoproteins in intestinal cells
23400816 Association of PCSK9 with LDL particles in plasma lowers the ability of PCSK9 to bind to cell surface LDLRs, thereby blunting PCSK9-mediated LDLR degradation.
23380588 No significant risks of coronary heart disease are associated with the LDLR gene rs1122608 polymorphisms in a case control series of Han Chinese.
23380568 The present study is the first to report the association between serum PCSK9 levels and carotid IMT in hypertensive patients. These results suggest that serum PCSK9 may have a certain role in early pathogenesis of atherosclerosis.
23333725 Data from patients/family members in Nijmegen, Netherlands, confirm that plasma PCSK9 levels are up-regulated in familial combined hyperlipidemia; up-regulation of PCSK9 levels are, in part, explained by high plasma lathosterol levels.
23329883 The subjects with AA genotype of the PCSK9 E670G benefit more from alcohol consumption than the subjects with AG genotype in decreasing serum TC and LDL-C levels
23308045 PCSK9 enhances liver metastasis development through its role in maintaining high circulating cholesterol levels and protects HepG2 cells, primary hepatocytes, and liver stroma and metastases against apoptosis.
23300213 lower cholesterol levels due to genetic variation in the PCSK9 gene are not associated with cognitive performance, functional status, or noncardiovascular clinical events
23283366 analysis of hypercholesterolemia and atherosclerosis in cloned minipigs created by DNA transposition of a human PCSK9 gain-of-function mutant
23135270 Furin-cleaved proprotein convertase subtilisin/kexin type 9 (PCSK9) is active and modulates low density lipoprotein receptor and serum cholesterol levels.
23106476 circulating PCSK9 levels correlate with thyroid function even in the normal range. This relationship appears to be blunted by obesity. Thyroid functional status may influence cholesterol metabolism through the PCSK9 pathway.
23105118 M2 is dispensable for secretion, its presence is required for the extracellular activity of PCSK9 on cell surface LDLR.
23085658 c-IAP1 acts on both secretion of PCSK9 and its lysosomal localization. The novel pathway described here will open new avenues for exploring novel disease treatments.
22875854 analysis of loss- and gain-of-function PCSK9 variants with cleavage specificity, dominant negative effects, and low density lipoprotein receptor (LDLR) degradation
22848640 AnxA2 acts as an endogenous regulator of PCSK9-induced LDLR degradation
22825241 PCSK9 expression is induced by oxidized low-density lipoprotein (oxLDL ).PCSK9 siRNA protects against inflammation via the inhibition of NF-kappaB activation in oxLDL-stimulated THP-1-derived macrophages.
22809551 There is no positive association of plasma PCSK9 with resistin in lean and moderately obese individuals.
22764087 LDLR-PCSK9 complex is internalized via clathrin-mediated endocytosis and then routed to lysosomes
22714699 Describe design of randomized controlled trial using PCSK9 inhibitor for the treatment of hypercholesterolemia.
22683370 In humans, plasma PCSK9 is cleared by LDLR-independent mechanisms.
22683120 Identify two new gain-of-function mutations of PCSK9 responsible for autosomal dominant hypercholesterolemia.
22611251 immunization with human-PCSK9 in mice is able to raise antibodies that cross-react and neutralize circulating mouse-PCSK9 protein thus resulting in increased liver LDL receptor levels and plasma cholesterol uptake
22493497 By reducing ENaC channel number, PCSK9 could modulate epithelial Na(+) absorption, a major contributor to blood pressure control.
22460556 Common and low-frequency genetic variants in the PCSK9 locus influence the pronounced interindividual variation in circulating PCSK9 levels in healthy, middle-aged white (predominantly Swedish) subjects.
22417841 A new missense variation (p.Pro174Ser) in the PCSK9 gene was identified and characterized as a new putative loss-of-function mutation.
22375030 Plasma PCSK9 levels are positively associated with LDL-C levels in FH patients and might contribute to the phenotypic severity in this disorder
22300679 Lp-PLA(2) and PCSK9 levels were both correlated positively with LDL cholesterol and non-high-density lipoprotein (HDL) cholesterol and Lp-PLA(2) was inversely related to PCSK9.
22288532 Knockdown of HINFP, NPAT or TRRAP each markedly reduces the amount of acetylated histone H4 on the PCSK9 promoter region and lowers PCSK9 protein levels
22207727 Endogenous estrogens lower plasma PCSK9 and LDL cholesterol but not Lp(a) or bile acid synthesis in women.
22176652 PCSK9 secreted by human smooth muscle cells is functionally active and capable of reducing LDLR expression in macrophages.
22095935 The prevalence and effect of mutations in PCSK9 in carriers of pathogenic autosomal dominant hypercholesterolemia mutations with unexpected low LDL-C levels.
22081141 PCSK9 seems to hold LDLR in an extended conformation and to interfere with conformational rearrangements required for LDLR recycling.
22074827 these data suggest that the ubiquitination system is involved in PCSK9-induced LDLR degradation.
22027821 An interaction between the prodomain and C-terminal domain regulates the secretion of PCSK9.
22005270 PCSK9 is likely involved in LDL-cholesterol metabolism, but it is not a clinically important regulator of VLDL kinetics in obese individuals.
22001517 Periodontal infection upregulates PCSK9 production. However, further studies are required to elucidate how periodontal infection affects PCSK9 concentrations and subsequent lipid metabolism
21920719 The variant L10 of the leucine repeats in PCSK9 modulates the lipid-lowering effects of statins in heterozygous lial hypercholesterolemia.
21889145 both PCSK9 and glycaemia are independent factors influencing LDL catabolism. Plasma PCSK9 influences significantly the catabolism of LDL-apoB100 in individuals without diabetes, but not in patients with uncontrolled type 2 diabetes.
21847580 ox-LDL-induced HUVECs apoptosis could be inhibited by PCSK9 siRNA, in which Bcl/Bax-caspase9-caspase3 pathway maybe was involved through reducing the Bcl-2/Bax ratio and inhibited the activation of both caspase9 and 3.
21829380 We found that in three loci (PCSK9, APOE, and LDLR) there were additional variants independently associated with LDL-C.
21813713 PCSK9-Q152H variant markedly lowers plasma PCSK9 and LDLC concentrations in heterozygous carriers via decreased autocatalytic processing and secretion, and hence, inactivity on the LDLR.
21771976 The C-terminal domain of PCSK9 plays a role in degradation of the LDL receptors.
21763412 Phaleria macrocarpa fruit aqueous extract reduced body weight/improved blood lipid profile of hypercholesterolemic rats. The improvement is likely to be regulated by LDL receptor and PCSK9.
21692990 measured the affinity and kinetics of binding of PCSK9 to LDLR on HepG2 cells at 4 degrees C; data suggest that PCSK9 binding to cell surface LDLR cannot be described by a simple bimolecular reaction
21619378 Several gain-of-function and loss-of-function mutations in the PCSK9 gene have been identified and linked to hypercholesterolemia and hypocholesterolemia, respectively [review]
21596380 PCSK9 mutations have a role in hypercholesterolemia, and circulating PCSK9 may be a biomarker of lipid metabolism [review]
21539517 plasma PCSK9 is a heritable trait associated with both familial combined hyperlipidaemia diagnostic hallmarks
21502677 Various polymorphisms, some of them previously unreported (*), in the PCSK9 gene (R46L, A53V, I474V, D480N*, E498K*) were found in familial hypobetalipoproteinemia
21497351 Plasma proprotein convertase subtilisin kexin type 9 is not altered in subjects with impaired glucose metabolism and type 2 diabetes mellitus, but its relationship with non-HDL cholesterol and apolipoprotein B may be modified by type 2 diabetes mellitus
21332221 Data provide a proteomic study of proteins affected by the stable overexpression of a gain-of-function PCSK9 membrane-bound chimera (PCSK9-V5-ACE2) in a human hepatocyte (HuH7) cell line.
21324305 Deletion of the acidic residues of the longest negatively charged segment increased PCSK9's ability to degrade the LDLR by 31%, whereas a modest 8% increase was observed when these residues were mutated to uncharged amino acids.
21196532 a cytokine-triggered regulatory network for PCSK9 expression that is linked to JAKs and the ERK signaling pathway
21149300 CT domain interaction with the LBD of the LDLR at endosomal pH constitutes a second step in the PCSK9-mediated LDLR binding that leads to receptor degradation.
21147780 in hepatocytes furin regulates PCSK9 mRNA levels and is the key in vivo-inactivating protease of circulating PCSK9.
21122860 Plasma PCSK9 levels are not increased by exposure to moderate 24h hyperinsulinemia in healthy and type 2 diabetic individuals.
21122852 The PCSK9 pathway may contribute to plasma apoM regulation in humans. The influence of PCSK9 on circulating apoM appears to be modified by adiposity.
21115573 These results enlarge the spectrum of autosomal dominant hypercholesterolaemia -causative LDLR and PCSK9 variations in Tunisia.
21069265 Data report that statins exert opposite effects on PCSK9 and Idol gene expression in human hepatoma-derived cell lines and primary hepatocytes isolated from hamsters and rats.
21040917 serum PCSK9 level may be a biomarker of metabolic status and cardiovascular disease in Han Chinese.
20972250 Observational study of gene-disease association. (HuGE Navigator)
20971364 Observational study of gene-disease association. (HuGE Navigator)
20937814 Effects of the prosegment and pH on the activity of PCSK9: evidence for additional processing events.
20884874 Throughout the day, and in response to fasting and cholesterol depletion, circulating PCSK9 displays marked variation, presumably related to oscillations in hepatic cholesterol that modify its activity in parallel with cholesterol synthesis.
20738937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20716520 fasting has a marked effect on plasma PCSK9 concentrations
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20699424 the association of R46L variant in PCSK9 gene with myocardial infarction (MI) in 1,880 Italian patients with premature MI
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20623344 PCSK9's expression, secretion, and plasma levels maybe modulated by the proprotein convertase furin, by natural inhibitors (annexin-A2), or influenced by lipid-altering agents such as statins, fibrates, ezetimibe, and berberine.
20619837 Fenofibrate and atorvastatin increased circulating PCSK9 in diabetic patients, with no additive effect after 6 weeks of combined therapy.
20589640 Data suggest that the thermodynamics observed for PCSK9-EGF-A binding stem from the functional replacement of water occupying stable PCSK9 hydration sites.
20579540 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20538126 Familial hypercholesterolemia is commonly caused by mutation in proprotein convertase subtilisin/kexin type 9 genes.
20529551 The R306S mutation could significantly lead to the decrease of LDL-R mature protein expression, which might be the pathogenic gene of the familial hypercholesterolemia family.
20498851 Locked nucleic acid antisense oligonucleotide efficiently reduced the mRNA and protein levels of PCSK9 with a concomitant increase in LDLR protein levels after transfection.
20453200 Data show that while PCSK9 directly bound to recombinant LDLR, VLDLR, and apoER2 protein in vitro, changes in PCSK9 expression did not alter the level of these receptors in the mouse brain, nor did it regulate BACE1 levels or APP processing.
20452593 PCSK9 has a role in regulating GGT level in diabetic patients, suggesting potential interaction between PCSK9 and liver function
20448210 Expression of D374Y PCSK9 at physiological levels produced a phenotype that closely matched that found in heterozygous D374Y patients and suggested that reduced low-density lipoprotein receptor activity is not the sole cause of their hypercholesterolemia.
20400780 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20333646 Identified novel pathways that are presumably regulated by PCSK9 in HepG2 cells and are independent of its effects on cholesterol uptake.
20308432 Observational study of gene-disease association. (HuGE Navigator)
20236128 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
20186155 Observational study of gene-disease association. (HuGE Navigator)
20172854 PCSK9 C-terminal domain contribute to its inhibition of LDLR function mainly through its role in the cellular uptake of PCSK9 and LDLR complex.
20167577 Observational study of gene-disease association. (HuGE Navigator)
20163833 Observational study of gene-disease association. (HuGE Navigator)
20145306 Observational study of gene-disease association. (HuGE Navigator)
20031607 The genetic variants of PCSK9 protein have persistently lower serum low-density lipoprotein cholesterol levels than noncarriers.
20031607 Observational study of gene-disease association. (HuGE Navigator)
20031582 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20006333 PCSK9 E32K significantly affects LDL-C levels via increased mass and function of PCSK9, and could exacerbate the clinical phenotypes of patients carrying LDLR mutations.
20006333 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19917273 In the presence of high LDL levels, wild-type-PCSK9, which has twice the binding affinity of R46L-PCSK9 to bind to the LDLR, may not be significantly more potent in degrading the LDLR than R46L-PCSK9.
19917273 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878649 These results suggest that PCSK9 does not alter insulin secretion.
19843101 Observational study of genetic testing. (HuGE Navigator)
19828345 Ubiquitination of lysines in the cytoplasmic domain does not appear to play a critical role in the PCSK9-mediated degradation of the LDLR.
19797716 The loss-of-function p.R46L variant is associated with the expected lower concentrations of circulating PCSK9; the gain-of-function p.D374Y mutation is also associated with lower concentrations.
19773416 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19762784 heterozygous PCSK9 missense mutations may associate with profound hypobetalipoproteinemia; decrease of plasma LDLC concentrations associated with PCSK9 mutations are attributable to an increased clearance rate of LDL
19713274 In men, variation in plasma PCSK9 concentration influences the catabolism of LDL apolipoprotein B-100.
19687008 Hepatocyte nuclear factor 1alpha plays a critical role in PCSK9 gene transcription and regulation by the natural hypocholesterolemic compound berberine
19667110 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19635789 analysis of PCSK9-induced low density lipoprotein receptor degradation
19619878 The E670G polymorphism of the PCSK9 gene is associated with increased intima media thickness progression in the general population
19619878 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19351729 Multiple metabolic and genetic factors contribute to variation in plasma levels of PCSK9 in the general population.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19319977 impact of PCSK9 polymorphism on LDL-cholesterol levels of FH patients carrying a same LDLR mutation
19319977 Observational study of gene-disease association. (HuGE Navigator)
19282863 Observational study of gene-disease association. (HuGE Navigator)
19265033 Proprotein convertase subtilisin kexin type 9 (PCSK9) was expressed almost exclusively in the epithelial barrier of the human duodenum and ileum.
19224862 Results support the concept that pharmacological inhibition of the PCSK9-LDLR interaction extracellularly will increase hepatic LDLR expression and lower plasma low density lipoprotein levels.
19222187 The data suggest the existence of distinct conformational states in free and receptor-bound PCSK9.
19198609 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19196236 These data indicate that antibodies targeting PCSK9 can reverse the PCSK9-mediated modulation of cell-surface LDLRs.
19191720 The results indicate that the E670G polymorphism of the PCSK9 gene modulates plasma LDL-C levels, but that it is not a risk variant for CAD in ethnic Chinese in Taiwan.
19191720 Observational study of gene-disease association. (HuGE Navigator)
19191301 Study highlighted the spectrum of hypercholesterolemia or hypobetalipoproteinemia phenotypes that are associated with mutations in PCSK9.
19179626 These data indicate that intestinal PCSK9 is highly modulated by sterols and emphasize the distinct effects of bile acid species.
19148283 Observational study of gene-disease association. (HuGE Navigator)
19081568 PCSK9-mediated LDLR degradation is not entirely dependent on ARH function
19060325 study provides evidence to support that PCSK9 proteins secreted from extrahepatic tissue are able to promote LDLR degradation in liver & increase plasma LDL; data suggest LDLR protein regulation by PCSK9 has tissue specificity, with liver most responsive
19022446 The S462P mutation in PCSK9 is believed to disrupt the normal folding of the C-terminal domain leading to retention of the mutant protein in the ER
19001363 Tyr-306 confers increased affinity for PCSK9
18799458 identification of the minimal inhibitory sequence of AnxA2 should pave the way toward the development of PCSK9 inhibitory lead molecules for the treatment of hypercholesterolemia
18753623 Domains in both the LDLR and PCSK9 that are not required for binding (or internalization) are essential for PCSK9-mediated degradation of the LDLR.
18710658 Truncating mutations in the apoB-100 gene are slightly more common as the cause of hypocholesterolemia compared to loss-of-function mutations in the PCSK9 gene.
18710658 Observational study of gene-disease association. (HuGE Navigator)
18708425 PCSK9 variants might contribute to FCHL phenotype and are to be taken into consideration in the study of this complex and multigenic disease with other genes implicated in dyslipidaemia
18680192 SNPs in PCSK9 were found as part of a chromosome 1p32 deletion, causing multiple abnormalities and low cholesterol levels.
18675252 These data demonstrate that while PCSK9 binds several receptors via its EGF-A binding domain, additional contacts with other receptor domains are also involved.
18660751 Data show that the serine protease PCSK9 (proprotein convertase subtilisin kexin type 9) contributes to the disposal of non-acetylated BACE1.
18652535 Ethnic differences in the frequency of the cardioprotective C679X PCSK9 mutation in a West African population are reported.
18649882 analysis of the molecular basis of PCSK9 function [review]
18631360 Site-directed mutagenesis experiments for 13 residues on a large conserved protrusion on the surface of the PCSK9 catalytic domain was performed.
18570182 Report genome-wide expression analysis of cells expressing gain of function mutant D374Y-PCSK9.
18559913 A new mutation that could cause autosomal dominant hypercholesterolemia by increasing the transcription of PCSK9.
18559913 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18499582 PCSK9 missense variant is associated with a reduced risk of early-onset myocardial infarction.
18498363 PCSK9 is phosphorylated by a Golgi casein kinase-like kinase ex vivo and circulates as a phosphoprotein in humans
18436227 variation in PCSK9 may contribute to genetic risk of peripheral arterial disease
18436227 Observational study of gene-disease association. (HuGE Navigator)
18406350 Secreted PCSK9 can potentially impact extrahepatic tissue cholesterol homeostasis by regulating extrahepatic tissue LDLR levels.
18355829 Berberine decreases PCSK9 expression in HepG2 cells
18354137 results suggest a model in which mutations at Ser127 and Asp374 residues modulate PCSK9's ability to regulate LDLR function through distinct mechanisms
18354102 Observational study of gene-disease association. (HuGE Navigator)
18343176 PCSK9 46L variant is associated with a significant reduction of LDL cholesterol.
18343176 Observational study of gene-disease association. (HuGE Navigator)
18300938 evolutionary dynamics may underlie the 'gain-of-function' mutations in PCSK9 that are associated with higher LDL cholesterol levels
18280815 PCSK9 expression has been shown to be regulated by sterol regulatory element binding proteins (SREBPs) and statins similar to other genes involved in cholesterol homeostasis[review]
18266662 This study has provided novel information about the structural requirements for the normal function of PCSK9. However, more studies are needed to determine the mechanisms by which gain-of-function mutations in PCSK9 cause hypercholesterolemia.
18262190 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18250299 structure of PCSK9 in complex with the LDLR EGF-A domain defines potential therapeutic target sites for blocking agents that could interfere with this interaction in vivo, thereby increasing LDLR function and reducing plasma LDL-C levels
18245819 fibrates simultaneously decreased PCSK9 expression while increasing PC5/6A and furin expression, indicating a broad action of PPARalpha activation in proprotein convertase-mediated lipid homeostasis.
18197702 PCSK9 also associated with LDL and HDL but not with VLDL. We conclude that self-association is an intrinsic property of PCSK9, correlated to its LDLR-degrading activity and affected by plasma lipoproteins
18193043 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18052825 a novel human PCSK9 splicing variant had an in-frame deletion of the eighth exon of 58 amino acids and was expressed in multiple tissues, including liver, small intestine, prostate, uterus, brain, and adipose tissue
18039658 the activity of PCSK9 and its binding affinity on VLDLR and ApoER2 does not depend on the presence of LDLR.
18039650 after stimulation, the protease activity of PC5A is enhanced, as evidenced by the cleavage of the PC5A substrates Lefty, ADAMTS-4, endothelial lipase, and PCSK9.
18028451 REVIEW: overview of mutations reported for the LDLR gene, the APOB gene, the PCSK9 gene, resulting in ADH.
18006936 The association of PCSK9 variation with incidence of cancer was studied prospectively study. The frequency of the PCSK9 variants studied was 2.4% in blacks and 3.2% in whites. Neither was associated with increased cancer.
18006936 Observational study of gene-disease association. (HuGE Navigator)
17971861 among primates, differential selective pressure has shaped evolutionary patterns in the functional domains of PCSK9, an important regulator of cholesterol homeostasis
17940607 PCSK9 gene is a risk factor of large-vessel atherosclerosis stroke
17940607 Observational study of gene-disease association. (HuGE Navigator)
17804797 The self-inhibited structure of full-length PCSK9 at 1.9A reveals structural homology with resistin within the C-terminal domain.
17765244 PCSK9 mediated inhibition of the LDL receptor does not require PCSK9 autocatalytic cleavage or secretion, suggesting that PCSK9 may also function intracellularly.
17702855 The circulating concentrations of human PCSK9 are directly correlated with LDL and total cholesterol concentrations.
17645871 These results suggest a gender difference in PCSK9 regulation and function with PCSK9 correlated to total cholesterol and high density lipoprotein cholesterol in men but not women.
17599443 Observational study of gene-disease association. (HuGE Navigator)
17599443 study analyzed association of 1 missense (R46L) & 2 nonsense (Y142X & C679X) PCSK9 mutations with serum LDL cholesterol in African-Americans & whites; results show these variants are associated with lower LDL cholesterol levels starting in childhood
17550346 Observational study of gene-disease association. (HuGE Navigator)
17539906 Observational study of genetic testing. (HuGE Navigator)
17537735 PCSK9 functions as a chaperone to prevent LDLR recycling and/or to target LDLRs for lysosomal degradation
17502100 Crystal structure is reported; its LDLR-lowering mechanism remains uncertain. The C-terminal domain has a novel protein fold and may mediate protein-protein interactions.
17495605 PCSK9 promotes the degradation of the LDL receptor in hepatocytes apparently both intracellularly and by being a secreted protein that can bind the LDL receptor and be internalized [review]
17461796 The sorting of PCSK9 to the cell surface and endosomes is required for PCSK9 to fully promote LDLR degradation.
17452316 proprotein convertase subtilisin/kexin type 9 binding to epidermal growth factor-like repeat A of low density lipoprotein receptor decreases receptor recycling and increases degradation
17449864 secreted PCSK9 retains biological activity, is able to bind directly to the LDLR extracellular domain, and undergoes LDLR-ARH-mediated endocytosis, leading to accelerated intracellular degradation of the LDLR.
17435765 PCSK9 binds the extracellular domain of LDL receptor; the D374Y gain-of-function mutant, associated with hypercholesterolemia and early-onset cardiovascular disease, binds the receptor 25 times more tightly than wild-type PCSK9
17391637 PCSK9 is definitely a major actor in cholesterol homeostasis--review
17351764 REVIEW OF ROLE OF PCSK9 AND PROPROTEIN CONVERTASES IN LIPID METABOLISM, DYSLIPIDEMIAS, AND CARDIOVASCULAR DISORDERS.
17328821 PCSK9-mediated degradation of the LDLR appears to take place intracellularly and occurs even when endocytosis through clathrin-coated pits is blocked by hypertonic medium.
17316651 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17316651 In a Japanese population, four missense mutations and one nonsense mutation inPCSK9 were identified only in individuals with low LDL-C; six missense mutations were identified only in individuals with high LDL-Cholesterol .
17142622 Observational study of genotype prevalence, gene-disease association, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17101087 Mutations and variations occur in hypercholesterolemia--a regulator of cholesterol metabolism.
17080197 secreted PCSK9 associates with the LDL receptors and reduces hepatic LDL receptors protein levels
16989838 the PCSK9 C679X variant has a marked cholesterol-lowering effect.
16912035 PCSK9 levels are finely regulated by the basic amino acid convertases furin and PC5/6A
16909389 PCSK9 plays a major role in determining plasma levels of LDL-C.
16875509 Observational study of gene-disease association. (HuGE Navigator)
16875509 In a European population the E670G SNP in the PCSK9 gene is associated with increased LDL in men but not in women
16619215 Observational study of gene-disease association. (HuGE Navigator)
16619215 A c.43_44insCTG variation in PCSK9 plays a role in lowering cholesterol in the general population.
16571601 PCSK9 (or a factor acted upon by PCSK9) is secreted from transfected cells and degrades low-density lipoprotein receptors both in transfected and untransfected cells.
16554528 Observational study of gene-disease association. (HuGE Navigator)
16554528 nonsense mutations in PCSK9 were associated with a reduction in mean LDL cholesterol and a reduction in the risk of coronary heart disease
16465619 Observational study of gene-disease association. (HuGE Navigator)
16465619 A spectrum of sequence variations of PCSK9 ranging in frequency (from 0.2% to 34%) and magnitude of effect (from a 3% increase to a 49% decrease) contribute to interindividual differences in LDL-C levels.
16407292 PCSK9 proximal promoter contains a functional sterol regulatory element binding transcription factor (SREBP-1c) located from 335 bp to 355 bp upstream of the ATG.
16314752 Genetic polymorphisms are not associated with Alzheimer disease and cholesterol in Japanese patients.
16224054 British PCSK9 patients with the D374Y mutation have an unpredictably severe clinical phenotype
16211558 Observational study of gene-disease association. (HuGE Navigator)
16211558 Mutations in the PCSK9 gene are associated with variable phenotype of autosomal dominant hypercholesterolemia.
16183066 Observational study of gene-disease association. (HuGE Navigator)
16183066 Rare missense mutations of PCSK9 may worsen the clinical phenotype of familial hypercholesterolemia patients carrying LDLR mutations.
16159606 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
15893176 Observational study of gene-disease association. (HuGE Navigator)
15772090 The cause of unusually severe dominant hypercholesterolemia is due to the effect of mutant PCKS9 on apolipoprotein B secretion.
15741654 PCSK9 has a role in LDL clearance but not in apoB-containing lipoprotein production
15358785 NARC-1 has a role in regulating both the level of LDLR and that of circulating apoB-containing lipoproteins in an LDLR-dependent and -independent fashion
15178557 PCSK9 regulation is typical of that of cholesterogenic genes, suggesting a role in cholesterol homeostasis. Human, mouse, and rat PCSK9 promoters contain 2 typical conserved motifs for cholesterol regulation: a sterol regulatory element & an Sp1 site.
15166014 The effect of the S127R mutation of PCSK9 on plasma cholesterol homeostasis is mainly related to an overproduction of apolipoprotein B100.
15099351 Observational study of gene-disease association. (HuGE Navigator)
15099351 mutations in the PCSK9 gene cause autosomal dominant hypercholesterolemia.
14727179 A mutation in PCSK9 causing autosomal-dominant hypercholesterolemia in a Utah pedigree. Mutation screening of genes in the region of interest identified a single nucleotide variant (G-->T).
14727156 Observational study of gene-disease association. (HuGE Navigator)
12730697 two mutations in the gene PCSK9 (encoding proprotein convertase subtilisin/kexin type 9) that cause autosomal dominant hypercholesterolemia

AA Sequence

MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKD      1 - 70
PWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHV     71 - 140
DYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPE    141 - 210
EDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPV    211 - 280
GPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGT    281 - 350
LGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSA    351 - 420
KDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFS    421 - 490
RSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLT    491 - 560
GCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGW    561 - 630
TLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ            631 - 692
//

Text Mined References (356)

PMID Year Title
27015087 2016 Genetic Variants of LDLR and PCSK9 Associated with Variations in Response to Antihypercholesterolemic Effects of Armolipid Plus with Berberine.
26896437 2016 Circulating Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Predicts Future Risk of Cardiovascular Events Independently of Established Risk Factors.
26833058 2016 Polydatin ameliorates lipid and glucose metabolism in type 2 diabetes mellitus by downregulating proprotein convertase subtilisin/kexin type 9 (PCSK9).
26824363 2016 Effect of Leptin Replacement on PCSK9 in ob/ob Mice and Female Lipodystrophic Patients.
26820623 2016 LDLR and PCSK9 Are Associated with the Presence of Antiphospholipid Antibodies and the Development of Thrombosis in aPLA Carriers.
26691006 2015 Identification of PCSK9 as a novel serum biomarker for the prenatal diagnosis of neural tube defects using iTRAQ quantitative proteomics.
26687699 Familial hypercholesterolemia: PCSK9 InsLEU genetic variant and prediabetes/diabetes risk.
26668321 2016 Suppressor of Cytokine Signaling-3 (SOCS-3) Induces Proprotein Convertase Subtilisin Kexin Type 9 (PCSK9) Expression in Hepatic HepG2 Cell Line.
26666837 2015 The Influence of OLR1 and PCSK9 Gene Polymorphisms on Ischemic Stroke: Evidence from a Meta-Analysis.
26632531 2016 Lipoprotein(a) in Familial Hypercholesterolemia With Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Gain-of-Function Mutations.
26576960 2015 The associations between proprotein convertase subtilisin/kexin type 9 E670G polymorphism and the risk of coronary artery disease and serum lipid levels: a meta-analysis.
26503748 2015 Proprotein convertase subtilisin/kexin type 9 inhibition: a new therapeutic mechanism for reducing cardiovascular disease risk.
26494228 2015 PCSK9 Induces CD36 Degradation and Affects Long-Chain Fatty Acid Uptake and Triglyceride Metabolism in Adipocytes and in Mouse Liver.
26493351 2016 Association of the variants and haplotypes in the DOCK7, PCSK9 and GALNT2 genes and the risk of hyperlipidaemia.
26490048 2015 Proprotein convertase subtilisin/kexin type 9 (PCSK9), soluble lectin-like oxidized LDL receptor 1 (sLOX-1) and ankle brachial index in patients with differentiated thyroid cancer.
26481479 2016 Up-regulation of liver Pcsk9 gene expression as a possible cause of hypercholesterolemia in experimental chronic renal failure.
26477595 2015 Genetics of coronary heart disease: towards causal mechanisms, novel drug targets and more personalized prevention.
26455563 2015 Focus on alirocumab: A PCSK9 antibody to treat hypercholesterolemia.
26413878 2015 A cholesterol-lowering VLP vaccine that targets PCSK9.
26412029 Plasma proprotein convertase subtilisin/kexin type 9 is associated with Lp(a) in type 2 diabetic patients.
26392590 2015 Proteolytic cleavage of antigen extends the durability of an anti-PCSK9 monoclonal antibody.
26377225 2016 Positive correlation of plasma PCSK9 levels with HbA1c in patients with type 2 diabetes.
26374825 2015 Characterization of Autosomal Dominant Hypercholesterolemia Caused by PCSK9 Gain of Function Mutations and Its Specific Treatment With Alirocumab, a PCSK9 Monoclonal Antibody.
26371983 2015 The contribution of PCSK9 levels to the phenotypic severity of familial hypercholesterolemia is independent of LDL receptor genotype.
26350813 The apoB-to-PCSK9 ratio: A new index for metabolic risk in humans.
26333678 2016 Local effects of human PCSK9 on the atherosclerotic lesion.
26195630 2015 Plasma Membrane Tetraspanin CD81 Complexes with Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) and Low Density Lipoprotein Receptor (LDLR), and Its Levels Are Reduced by PCSK9.
26143741 2016 Marine n-3 polyunsaturated fatty acids lower plasma proprotein convertase subtilisin kexin type 9 levels in pre- and postmenopausal women: A randomised study.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26085104 2015 Amyloid Precursor-like Protein 2 and Sortilin Do Not Regulate the PCSK9 Convertase-mediated Low Density Lipoprotein Receptor Degradation but Interact with Each Other.
26056005 2015 Selection and characterization of human PCSK9 antibody from phage displayed antibody library.
26049403 2015 The loss-of-function PCSK9 p.R46L genetic variant does not alter glucose homeostasis.
26048378 2015 Antihyperlipidemic therapies targeting PCSK9: Novel therapeutic agents for lowering low-density lipoprotein cholesterol.
26045785 2015 PCSK9 regulates apoptosis in human neuroglioma u251 cells via mitochondrial signaling pathways.
26004275 2015 [Cholesterol associated to low density lipoproteins (LDL) and vascular risk reduction. Proprotein convertase subtilisin/kexin type 9 (PCSK9): A new therapeutic target].
25936324 2015 Effects of lipoprotein apheresis on PCSK9 levels.
25913303 2015 ?-Estradiol results in a proprotein convertase subtilisin/kexin type 9-dependent increase in low-density lipoprotein receptor levels in human hepatic HuH7 cells.
25911073 Understanding PCSK9 and anti-PCSK9 therapies.
25905719 2015 Common Proprotein Convertase Subtilisin/Kexin Type 9 (PCSK9) Epitopes Mediate Multiple Routes for Internalization and Function.
25899039 2015 Combined PCSK9 and APOE polymorphisms are genetic risk factors associated with elevated plasma lipid levels in a Thai population.
25887680 2015 Role of PCSK9 beyond liver involvement.
25881720 2015 Recent advances in the understanding and care of familial hypercholesterolaemia: significance of the biology and therapeutic regulation of proprotein convertase subtilisin/kexin type 9.
25858546 2015 Relationship between testosterone, estradiol and circulating PCSK9: Cross-sectional and interventional studies in humans.
25857271 2015 Serum proprotein convertase subtilisin/kexin type 9 concentration is not increased by plant stanol ester consumption in normo- to moderately hypercholesterolaemic non-obese subjects. The BLOOD FLOW intervention study.
25839937 2015 Next generation sequencing to identify novel genetic variants causative of autosomal dominant familial hypercholesterolemia associated with increased risk of coronary heart disease.
25778403 2015 Lipoprotein(a) catabolism is regulated by proprotein convertase subtilisin/kexin type 9 through the low density lipoprotein receptor.
25770756 2015 Association of plasma small dense LDL cholesterol with PCSK9 levels in patients with angiographically proven coronary artery disease.
25744035 2015 Characterisation of de novo mutations in the C-terminal domain of proprotein convertase subtilisin/kexin type 9.
25665485 2015 The effects of estrogen on serum level and hepatocyte expression of PCSK9.
25652089 2015 Reduction of circulating PCSK9 and LDL-C levels by liver-specific knockdown of HNF1? in normolipidemic mice.
25613181 2015 MMP-2 inhibits PCSK9-induced degradation of the LDL receptor in Hepa1-c1c7 cells.
25496400 2014 Relation of plasma PCSK9 levels to lipoprotein subfractions in patients with stable coronary artery disease.
25490141 2015 Hemodynamic shear stress via ROS modulates PCSK9 expression in human vascular endothelial and smooth muscle cells and along the mouse aorta.
25466598 2015 ABO blood group in relation to plasma lipids and proprotein convertase subtilisin/kexin type 9.
25453988 2015 A genetic basis for coronary artery disease.
25444750 2015 PCSK9 and its modulation.
25412415 2015 Both rare and common variants in PCSK9 influence plasma low-density lipoprotein cholesterol level in American Indians.
25410128 2015 PCSK9: A key factor modulating atherosclerosis.
25341796 2015 Induction of sustained hypercholesterolemia by single adeno-associated virus-mediated gene transfer of mutant hPCSK9.
25320235 2014 PCSK9 is a critical regulator of the innate immune response and septic shock outcome.
25278291 2014 PCSK9 R46L, lower LDL, and cardiovascular disease risk in familial hypercholesterolemia: a cross-sectional cohort study.
25266949 2014 Correlation of PCSK9 gene polymorphism with cerebral ischemic stroke in Xinjiang Han and Uygur populations.
25258384 2014 PCSK9 inhibition fails to alter hepatic LDLR, circulating cholesterol, and atherosclerosis in the absence of ApoE.
25239117 2015 PCSK9 polymorphism in a Tunisian cohort: identification of a new allele, L8, and association of allele L10 with reduced coronary heart disease risk.
25234562 Relation of circulating PCSK9 concentration to fibrinogen in patients with stable coronary artery disease.
25222343 2014 Sorting an LDL receptor with bound PCSK9 to intracellular degradation.
25210046 2014 The proprotein convertase subtilisin/kexin type 9 (PCSK9) active site and cleavage sequence differentially regulate protein secretion from proteolysis.
25180781 2014 Plasma PCSK9 levels are elevated with acute myocardial infarction in two independent retrospective angiographic studies.
25172631 2014 Thyroid hormone reduces PCSK9 and stimulates bile acid synthesis in humans.
25164566 2014 Curcumin enhances cell-surface LDLR level and promotes LDL uptake through downregulation of PCSK9 gene expression in HepG2 cells.
25128757 2014 PCSK9 levels in abdominally obese men: association with cardiometabolic risk profile and effects of a one-year lifestyle modification program.
25110901 2014 PCSK9 and LDLR degradation: regulatory mechanisms in circulation and in cells.
25070550 2014 Proprotein convertase subtilisin kexin type 9 promotes intestinal overproduction of triglyceride-rich apolipoprotein B lipoproteins through both low-density lipoprotein receptor-dependent and -independent mechanisms.
25062564 2014 Preserved adrenal function in fully PCSK9-deficient subject.
25014035 2014 Genotypic and phenotypic features in homozygous familial hypercholesterolemia caused by proprotein convertase subtilisin/kexin type 9 (PCSK9) gain-of-function mutation.
24808179 2014 Annexin A2 reduces PCSK9 protein levels via a translational mechanism and interacts with the M1 and M2 domains of PCSK9.
24801085 2014 Plasma PCSK9 levels are associated with the severity of coronary stenosis in patients with atherosclerosis.
24793346 Influence of PCSK9 polymorphisms on plasma lipids and response to atorvastatin treatment in Brazilian subjects.
24769476 2014 Association of plasma PCSK9 levels with white blood cell count and its subsets in patients with stable coronary artery disease.
24721682 2014 The effect of insulin on circulating PCSK9 in postmenopausal obese women.
24685817 2014 Risk prediction with proprotein convertase subtilisin/kexin type 9 (PCSK9) in patients with stable coronary disease on statin treatment.
24659111 2014 PCSK9 is present in human cerebrospinal fluid and is maintained at remarkably constant concentrations throughout the course of the day.
24632287 2014 Elevated plasma PCSK9 level is equally detrimental for patients with nonfamilial hypercholesterolemia and heterozygous familial hypercholesterolemia, irrespective of low-density lipoprotein receptor defects.
24625727 2014 PCSK9: a key modulator of cardiovascular health.
24599757 2014 Effect of E670G Polymorphism in PCSK9 Gene on the Risk and Severity of Coronary Heart Disease and Ischemic Stroke in a Tunisian Cohort.
24529132 2014 Chronic kidney disease on hemodialysis is associated with decreased serum PCSK9 levels.
24518357 2014 PCSK9 gene mutations and low-density lipoprotein cholesterol.
24486405 2014 Having excess levels of PCSK9 is not sufficient to induce complex formation between PCSK9 and the LDL receptor.
24315769 2014 Plasma PCSK9 in nephrotic syndrome and in peritoneal dialysis: a cross-sectional study.
24308640 2014 Circulating PCSK9 is a strong determinant of plasma triacylglycerols and total cholesterol in homozygous carriers of apolipoprotein ?2.
24296664 2014 Internalized PCSK9 dissociates from recycling LDL receptors in PCSK9-resistant SV-589 fibroblasts.
24225950 2014 Identification of a small peptide that inhibits PCSK9 protein binding to the low density lipoprotein receptor.
24144304 2014 PCSK9 acts as a chaperone for the LDL receptor in the endoplasmic reticulum.
24134510 2013 PCSK9 and resistin at the crossroads of the atherogenic dyslipidemia.
24122718 2013 Loss of plasma proprotein convertase subtilisin/kexin 9 (PCSK9) after lipoprotein apheresis.
24103783 2013 Characterization of the role of EGF-A of low density lipoprotein receptor in PCSK9 binding.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23925411 2014 [PCSK9 as new target in hyperlipidemia treatment].
23817198 2013 The promises of PCSK9 inhibition.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
23743349 2013 Regional distribution and metabolic effect of PCSK9 insLEU and R46L gene mutations and apoE genotype.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23675525 2013 Proprotein convertase subtilisin/kexin type 9 (PCSK9) can mediate degradation of the low density lipoprotein receptor-related protein 1 (LRP-1).
23669246 2013 Analysis of the frequency and spectrum of mutations recognised to cause familial hypercholesterolaemia in routine clinical practice in a UK specialist hospital lipid clinic.
23663650 2013 Differential effects of PCSK9 loss of function variants on serum lipid and PCSK9 levels in Caucasian and African Canadian populations.
23623011 2013 Beyond LDL-C lowering: distinct molecular sphingolipids are good indicators of proprotein convertase subtilisin/kexin type 9 (PCSK9) deficiency.
23593297 2013 Genetic polymorphisms in LDLR, APOB, PCSK9 and other lipid related genes associated with familial hypercholesterolemia in Malaysia.
23559630 2013 Transintestinal cholesterol excretion is an active metabolic process modulated by PCSK9 and statin involving ABCB1.
23553812 2013 Evaluation of proprotein convertase subtilisin/kexin type 9: focus on potential clinical and therapeutic implications for low-density lipoprotein cholesterol lowering.
23537802 2013 Elevated PCSK9 levels in untreated patients with heterozygous or homozygous familial hypercholesterolemia and the response to high-dose statin therapy.
23535506 2013 The genetic spectrum of familial hypercholesterolemia in Pakistan.
23509406 2013 PCSK9-mediated degradation of the LDL receptor generates a 17 kDa C-terminal LDL receptor fragment.
23499248 2013 Proprotein convertase subtilisin/kexin type 9 potentially influences cholesterol uptake in macrophages and reverse cholesterol transport.
23466067 2013 The safety of therapeutic monoclonal antibodies: implications for cardiovascular disease and targeting the PCSK9 pathway.
23450051 2013 Plasma PCSK9 is a late biomarker of severity in patients with severe trauma injury.
23430252 2013 Characterization of proprotein convertase subtilisin/kexin type 9 (PCSK9) trafficking reveals a novel lysosomal targeting mechanism via amyloid precursor-like protein 2 (APLP2).
23422832 2013 PCSK9 plays a significant role in cholesterol homeostasis and lipid transport in intestinal epithelial cells.
23400816 2013 Low density lipoprotein binds to proprotein convertase subtilisin/kexin type-9 (PCSK9) in human plasma and inhibits PCSK9-mediated low density lipoprotein receptor degradation.
23380588 2013 Association between PCSK9 and LDLR gene polymorphisms with coronary heart disease: case-control study and meta-analysis.
23380568 2013 Association of serum proprotein convertase subtilisin/kexin type 9 with carotid intima media thickness in hypertensive subjects.
23333725 2013 Plasma proprotein convertase subtilisin kexin type 9 levels are related to markers of cholesterol synthesis in familial combined hyperlipidemia.
23329883 2013 Proprotein convertase subtilisin/kexin type 9 gene E670G polymorphism interacts with alcohol consumption to modulate serum lipid levels.
23308045 2012 Proprotein convertase subtilisin/kexin type 9 deficiency reduces melanoma metastasis in liver.
23300213 2013 PCSK9 SNP rs11591147 is associated with low cholesterol levels but not with cognitive performance or noncardiovascular clinical events in an elderly population.
23283366 2013 Familial hypercholesterolemia and atherosclerosis in cloned minipigs created by DNA transposition of a human PCSK9 gain-of-function mutant.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23135270 2012 Furin-cleaved proprotein convertase subtilisin/kexin type 9 (PCSK9) is active and modulates low density lipoprotein receptor and serum cholesterol levels.
23106476 2013 Adiposity blunts the positive relationship of thyrotropin with proprotein convertase subtilisin-kexin type 9 levels in euthyroid subjects.
23105118 2012 The M2 module of the Cys-His-rich domain (CHRD) of PCSK9 protein is needed for the extracellular low-density lipoprotein receptor (LDLR) degradation pathway.
23085658 2012 c-IAP1 binds and processes PCSK9 protein: linking the c-IAP1 in a TNF-? pathway to PCSK9-mediated LDLR degradation pathway.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22875854 2012 Loss- and gain-of-function PCSK9 variants: cleavage specificity, dominant negative effects, and low density lipoprotein receptor (LDLR) degradation.
22848640 2012 Annexin A2 is a natural extrahepatic inhibitor of the PCSK9-induced LDL receptor degradation.
22825241 2012 PCSK9 siRNA suppresses the inflammatory response induced by oxLDL through inhibition of NF-?B activation in THP-1-derived macrophages.
22809551 2012 Relationship of proprotein convertase subtilisin-kexin type 9 levels with resistin in lean and obese subjects.
22764087 2012 Molecular characterization of proprotein convertase subtilisin/kexin type 9-mediated degradation of the LDLR.
22714699 2012 Design and rationale of the LAPLACE-TIMI 57 trial: a phase II, double-blind, placebo-controlled study of the efficacy and tolerability of a monoclonal antibody inhibitor of PCSK9 in subjects with hypercholesterolemia on background statin therapy.
22683370 2012 Serum levels of proprotein convertase subtilisin/kexin type 9 in subjects with familial hypercholesterolemia indicate that proprotein convertase subtilisin/kexin type 9 is cleared from plasma by low-density lipoprotein receptor-independent pathways.
22683120 2012 Identification and characterization of new gain-of-function mutations in the PCSK9 gene responsible for autosomal dominant hypercholesterolemia.
22679642 2012 The biology and therapeutic targeting of the proprotein convertases.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22611251 2012 Immunization against proprotein convertase subtilisin-like/kexin type 9 lowers plasma LDL-cholesterol levels in mice.
22580899 2012 Proprotein convertase subtilisin/kexin type 9 interacts with apolipoprotein B and prevents its intracellular degradation, irrespective of the low-density lipoprotein receptor.
22544364 2012 A genome-wide association study identifies susceptibility loci for Wilms tumor.
22493497 2012 Regulation of epithelial sodium channel trafficking by proprotein convertase subtilisin/kexin type 9 (PCSK9).
22460556 2012 Common and low-frequency genetic variants in the PCSK9 locus influence circulating PCSK9 levels.
22417841 2012 Effect of mutations in LDLR and PCSK9 genes on phenotypic variability in Tunisian familial hypercholesterolemia patients.
22375030 2012 Plasma levels of PCSK9 and phenotypic variability in familial hypercholesterolemia.
22331829 2012 Genetic determinants of statin-induced low-density lipoprotein cholesterol reduction: the Justification for the Use of Statins in Prevention: an Intervention Trial Evaluating Rosuvastatin (JUPITER) trial.
22300679 2012 Plasma lipoprotein-associated phospholipase A2 is inversely correlated with proprotein convertase subtilisin-kexin type 9.
22288532 2012 The novel function of HINFP as a co-activator in sterol-regulated transcription of PCSK9 in HepG2 cells.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22207727 2012 Endogenous estrogens lower plasma PCSK9 and LDL cholesterol but not Lp(a) or bile acid synthesis in women.
22176652 2012 Proprotein convertase subtilisin kexin type 9 (PCSK9) secreted by cultured smooth muscle cells reduces macrophages LDLR levels.
22095935 2012 Genetic variation in APOB, PCSK9, and ANGPTL3 in carriers of pathogenic autosomal dominant hypercholesterolemic mutations with unexpected low LDL-Cl Levels.
22081141 2011 Mechanistic implications for LDL receptor degradation from the PCSK9/LDLR structure at neutral pH.
22074827 2011 Role of ubiquitination in PCSK9-mediated low-density lipoprotein receptor degradation.
22027821 2011 Novel domain interaction regulates secretion of proprotein convertase subtilisin/kexin type 9 (PCSK9) protein.
22005270 2011 Lack of a relationship between plasma PCSK9 concentrations and hepatic lipoprotein kinetics in obese people.
22001517 2012 Increased serum PCSK9 concentrations are associated with periodontal infection but do not correlate with LDL cholesterol concentration.
21943799 2011 Proprotein convertase subtilisin/kexin type 9 (PCSK9): from structure-function relation to therapeutic inhibition.
21920719 2012 Leucine 10 allelic variant in signal peptide of PCSK9 increases the LDL cholesterol-lowering effect of statins in patients with familial hypercholesterolaemia.
21889145 2011 Lack of association between plasma PCSK9 and LDL-apoB100 catabolism in patients with uncontrolled type 2 diabetes.
21847580 2012 PCSK9 siRNA inhibits HUVEC apoptosis induced by ox-LDL via Bcl/Bax-caspase9-caspase3 pathway.
21829380 2011 Fine mapping of five loci associated with low-density lipoprotein cholesterol detects variants that double the explained heritability.
21813713 2011 Novel loss-of-function PCSK9 variant is associated with low plasma LDL cholesterol in a French-Canadian family and with impaired processing and secretion in cell culture.
21805237 2011 The proprotein convertases, 20 years later.
21805236 2011 The prohormone theory and the proprotein convertases: it is all about serendipity.
21771976 2011 Role of the C-terminal domain of PCSK9 in degradation of the LDL receptors.
21763412 2011 Phaleria macrocarpa (Scheff.) Boerl fruit aqueous extract enhances LDL receptor and PCSK9 expression in vivo and in vitro.
21692990 2011 Affinity and kinetics of proprotein convertase subtilisin/kexin type 9 binding to low-density lipoprotein receptors on HepG2 cells.
21619378 2011 The role of proprotein convertase subtilisin/kexin type 9 in hyperlipidemia: focus on therapeutic implications.
21596380 2011 Clinical aspects of PCSK9.
21539517 2011 Plasma proprotein convertase subtilisin kexin type 9 is a heritable trait of familial combined hyperlipidaemia.
21502677 Familial hypobetalipoproteinemia in a hospital survey: genetics, metabolism and non-alcoholic fatty liver disease.
21497351 2011 Plasma proprotein convertase subtilisin kexin type 9 is not altered in subjects with impaired glucose metabolism and type 2 diabetes mellitus, but its relationship with non-HDL cholesterol and apolipoprotein B may be modified by type 2 diabetes mellitus: The CODAM study.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21332221 2011 Quantitative proteomic analysis of PCSK9 gain of function in human hepatic HuH7 cells.
21324305 2011 Removal of acidic residues of the prodomain of PCSK9 increases its activity towards the LDL receptor.
21196532 2011 Janus kinase activation by cytokine oncostatin M decreases PCSK9 expression in liver cells.
21149300 2011 A two-step binding model of PCSK9 interaction with the low density lipoprotein receptor.
21147780 2011 In vivo evidence that furin from hepatocytes inactivates PCSK9.
21122860 2011 Plasma proprotein convertase subtilisin-kexin type 9 does not change during 24h insulin infusion in healthy subjects and type 2 diabetic patients.
21122852 2011 Relationship of plasma apolipoprotein M with proprotein convertase subtilisin-kexin type 9 levels in non-diabetic subjects.
21115573 2011 Effect of a splice site mutation in LDLR gene and two variations in PCSK9 gene in Tunisian families with familial hypercholesterolaemia.
21069265 2011 Suppression of Idol expression is an additional mechanism underlying statin-induced up-regulation of hepatic LDL receptor expression.
21040917 2010 Serum PCSK9 is associated with multiple metabolic factors in a large Han Chinese population.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20971364 2010 A multilocus genetic risk score for coronary heart disease: case-control and prospective cohort analyses.
20937814 2010 Effects of the prosegment and pH on the activity of PCSK9: evidence for additional processing events.
20884874 2010 Circulating proprotein convertase subtilisin kexin type 9 has a diurnal rhythm synchronous with cholesterol synthesis and is reduced by fasting in humans.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20738937 2010 Additive effect of multiple genetic variants on the risk of coronary artery disease.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20716520 2010 Fasting reduces plasma proprotein convertase, subtilisin/kexin type 9 and cholesterol biosynthesis in humans.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20699424 2010 Effects of PCSK9 genetic variants on plasma LDL cholesterol levels and risk of premature myocardial infarction in the Italian population.
20691829 2010 Joint effects of common genetic variants from multiple genes and pathways on the risk of premature coronary artery disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20623344 2010 The influence of PCSK9 polymorphisms on serum low-density lipoprotein cholesterol and risk of atherosclerosis.
20619837 2010 Plasma PCSK9 is increased by fenofibrate and atorvastatin in a non-additive fashion in diabetic patients.
20589640 2010 New hypotheses about the structure-function of proprotein convertase subtilisin/kexin type 9: analysis of the epidermal growth factor-like repeat A docking site using WaterMap.
20579540 2010 PCSK9 R46L, low-density lipoprotein cholesterol levels, and risk of ischemic heart disease: 3 independent studies and meta-analyses.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20538126 2010 Detection of mutations and large rearrangements of the low-density lipoprotein receptor gene in Taiwanese patients with familial hypercholesterolemia.
20529551 2010 A novel mutation in proprotein convertase subtilisin/kexin type 9 gene leads to familial hypercholesterolemia in a Chinese family.
20498851 2010 A locked nucleic acid antisense oligonucleotide (LNA) silences PCSK9 and enhances LDLR expression in vitro and in vivo.
20453200 2010 PCSK9 is not involved in the degradation of LDL receptors and BACE1 in the adult mouse brain.
20452593 2010 Association between plasma PCSK9 and gamma-glutamyl transferase levels in diabetic patients.
20448210 2010 Increased secretion of lipoproteins in transgenic mice expressing human D374Y PCSK9 under physiological genetic control.
20400780 2010 Candidate gene association resource (CARe): design, methods, and proof of concept.
20333646 2010 Proprotein convertase subtilisin/kexin type 9 (PCSK9) affects gene expression pathways beyond cholesterol metabolism in liver cells.
20308432 2010 Association analysis of 33 lipoprotein candidate genes in multi-generational families of African ancestry.
20236128 2010 Mutation detection rate and spectrum in familial hypercholesterolaemia patients in the UK pilot cascade project.
20186155 2010 Concordance of two multiple analytical approaches demonstrate that interaction between BMI and ADIPOQ haplotypes is a determinant of LDL cholesterol in a general French population.
20172854 2010 A proprotein convertase subtilisin-like/kexin type 9 (PCSK9) C-terminal domain antibody antigen-binding fragment inhibits PCSK9 internalization and restores low density lipoprotein uptake.
20167577 2010 Analysis of lipid pathway genes indicates association of sequence variation near SREBF1/TOM1L2/ATPAF2 with dementia risk.
20163833 2010 Association study between three polymorphisms and myocardial infarction and ischemic stroke in Chinese Han population.
20145306 2010 Molecular characterization of Polish patients with familial hypercholesterolemia: novel and recurrent LDLR mutations.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20031607 2009 Longitudinal association of PCSK9 sequence variations with low-density lipoprotein cholesterol levels: the Coronary Artery Risk Development in Young Adults Study.
20031582 2009 Comprehensive whole-genome and candidate gene analysis for response to statin therapy in the Treating to New Targets (TNT) cohort.
20006333 2010 The E32K variant of PCSK9 exacerbates the phenotype of familial hypercholesterolaemia by increasing PCSK9 function and concentration in the circulation.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19930098 2009 The unique role of proprotein convertase subtilisin/kexin 9 in cholesterol homeostasis.
19917273 2010 Loss-of-function mutation R46L in the PCSK9 gene has little impact on the levels of total serum cholesterol in familial hypercholesterolemia heterozygotes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878649 2009 PCSK9 is expressed in pancreatic delta-cells and does not alter insulin secretion.
19843101 2010 Mutation screening in patients for familial hypercholesterolaemia (ADH).
19828345 2010 A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9.
19797716 2009 Healthy individuals carrying the PCSK9 p.R46L variant and familial hypercholesterolemia patients carrying PCSK9 p.D374Y exhibit lower plasma concentrations of PCSK9.
19773416 2010 A gene score of nine LDL and HDL regulating genes is associated with fluvastatin-induced cholesterol changes in women.
19762784 2009 PCSK9 dominant negative mutant results in increased LDL catabolic rate and familial hypobetalipoproteinemia.
19713274 2009 Plasma proprotein convertase subtilisin/kexin type 9: a marker of LDL apolipoprotein B-100 catabolism?
19687008 2009 Hepatocyte nuclear factor 1alpha plays a critical role in PCSK9 gene transcription and regulation by the natural hypocholesterolemic compound berberine.
19667110 2009 Identification of genetic variants associated with response to statin therapy.
19635789 2009 Dissection of the endogenous cellular pathways of PCSK9-induced low density lipoprotein receptor degradation: evidence for an intracellular route.
19619878 2010 Effects of PCSK9 variants on common carotid artery intima media thickness and relation to ApoE alleles.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19351729 2009 Genetic and metabolic determinants of plasma PCSK9 levels.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19319977 2009 The molecular basis of familial hypercholesterolemia in Lebanon: spectrum of LDLR mutations and role of PCSK9 as a modifier gene.
19282863 2009 Association of candidate gene polymorphisms with chronic kidney disease in Japanese individuals with hypertension.
19265033 2009 Proprotein convertase subtilisin kexin type 9 null mice are protected from postprandial triglyceridemia.
19224862 2009 Antagonism of secreted PCSK9 increases low density lipoprotein receptor expression in HepG2 cells.
19222187 2009 Binding to the low-density lipoprotein receptor accelerates futile catalytic cycling in PCSK9 and raises the equilibrium level of intramolecular acylenzyme.
19198609 2009 Genome-wide association of early-onset myocardial infarction with single nucleotide polymorphisms and copy number variants.
19196236 2009 Antibody-mediated disruption of the interaction between PCSK9 and the low-density lipoprotein receptor.
19191720 2009 The PCSK9 gene E670G polymorphism affects low-density lipoprotein cholesterol levels but is not a risk factor for coronary artery disease in ethnic Chinese in Taiwan.
19191301 2009 Mutations and polymorphisms in the proprotein convertase subtilisin kexin 9 (PCSK9) gene in cholesterol metabolism and disease.
19179626 2009 Regulation of the proprotein convertase subtilisin/kexin type 9 in intestinal epithelial cells.
19148283 2009 Genetic differences between the determinants of lipid profile phenotypes in African and European Americans: the Jackson Heart Study.
19081568 2009 Degradation of LDLR protein mediated by 'gain of function' PCSK9 mutants in normal and ARH cells.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19060325 2009 Function and distribution of circulating human PCSK9 expressed extrahepatically in transgenic mice.
19022446 2009 Mutation S462P in the PCSK9 gene reduces secretion of mutant PCSK9 without affecting the autocatalytic cleavage.
19020338 2009 PCSK9: a convertase that coordinates LDL catabolism.
19001363 2009 Structural and biochemical characterization of the wild type PCSK9-EGF(AB) complex and natural familial hypercholesterolemia mutants.
18799458 2008 Annexin A2 is a C-terminal PCSK9-binding protein that regulates endogenous low density lipoprotein receptor levels.
18753623 2008 Structural requirements for PCSK9-mediated degradation of the low-density lipoprotein receptor.
18710658 2008 Identification of mutations in the apolipoprotein B-100 gene and in the PCSK9 gene as the cause of hypocholesterolemia.
18708425 2008 A PCSK9 variant and familial combined hyperlipidaemia.
18680192 2008 Deletion (1)(p32.2-p32.3) detected by array-CGH in a patient with developmental delay/mental retardation, dysmorphic features and low cholesterol: A new microdeletion syndrome?
18675252 2008 PCSK9 binds to multiple receptors and can be functionally inhibited by an EGF-A peptide.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660751 2008 PCSK9 is required for the disposal of non-acetylated intermediates of the nascent membrane protein BACE1.
18652535 2008 Ethnic differences in the frequency of the cardioprotective C679X PCSK9 mutation in a West African population.
18649882 2009 Molecular basis of PCSK9 function.
18631360 2008 Investigations on the evolutionary conservation of PCSK9 reveal a functionally important protrusion.
18570182 2008 Genome-wide expression analysis of cells expressing gain of function mutant D374Y-PCSK9.
18559913 2008 A new PCSK9 gene promoter variant affects gene expression and causes autosomal dominant hypercholesterolemia.
18499582 2008 A PCSK9 missense variant associated with a reduced risk of early-onset myocardial infarction.
18498363 2008 PCSK9 is phosphorylated by a Golgi casein kinase-like kinase ex vivo and circulates as a phosphoprotein in humans.
18436227 2009 Variation in PCSK9, low LDL cholesterol, and risk of peripheral arterial disease.
18406350 2008 Secreted proprotein convertase subtilisin/kexin type 9 reduces both hepatic and extrahepatic low-density lipoprotein receptors in vivo.
18355829 2008 Berberine decreases PCSK9 expression in HepG2 cells.
18354137 2008 Functional analysis of sites within PCSK9 responsible for hypercholesterolemia.
18354102 2008 Polymorphisms associated with cholesterol and risk of cardiovascular events.
18343183 2008 The activation and physiological functions of the proprotein convertases.
18343176 2008 Effect of protein convertase subtilisin/kexin type 9 (PCSK9) 46L gene polymorphism on LDL cholesterol concentration in a Polish adult population.
18300938 2008 Molecular population genetics of PCSK9: a signature of recent positive selection.
18280815 2008 PCSK9: an enigmatic protease.
18266662 2008 Characterization of novel mutations in the catalytic domain of the PCSK9 gene.
18262190 2008 Genetic variation at the PCSK9 locus moderately lowers low-density lipoprotein cholesterol levels, but does not significantly lower vascular disease risk in an elderly population.
18250299 2008 Molecular basis for LDL receptor recognition by PCSK9.
18245819 2008 Dual mechanisms for the fibrate-mediated repression of proprotein convertase subtilisin/kexin type 9.
18197702 2008 Self-association of human PCSK9 correlates with its LDLR-degrading activity.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
18052825 2008 A novel splicing variant of proprotein convertase subtilisin/kexin type 9.
18039658 2008 The proprotein convertase PCSK9 induces the degradation of low density lipoprotein receptor (LDLR) and its closest family members VLDLR and ApoER2.
18039650 2008 The regulated cell surface zymogen activation of the proprotein convertase PC5A directs the processing of its secretory substrates.
18028451 2008 Genetic heterogeneity of autosomal dominant hypercholesterolemia.
18006936 2007 Sequence variation in proprotein convertase subtilisin/kexin type 9 serine protease gene, low LDL cholesterol, and cancer incidence.
17971861 2007 Evidence for positive selection in the C-terminal domain of the cholesterol metabolism gene PCSK9 based on phylogenetic analysis in 14 primate species.
17940607 2007 Proprotein convertase subtilisin/kexin type 9 (PCSK9) gene is a risk factor of large-vessel atherosclerosis stroke.
17804797 2007 The self-inhibited structure of full-length PCSK9 at 1.9 A reveals structural homology with resistin within the C-terminal domain.
17765244 2008 Identification and characterization of two non-secreted PCSK9 mutants associated with familial hypercholesterolemia in cohorts from New Zealand and South Africa.
17702855 2007 Serum proprotein convertase subtilisin kexin type 9 is correlated directly with serum LDL cholesterol.
17645871 2007 Plasma PCSK9 levels correlate with cholesterol in men but not in women.
17599443 2007 Relation of PCSK9 mutations to serum low-density lipoprotein cholesterol in childhood and adulthood (from The Bogalusa Heart Study).
17550346 2007 The PCSK9 gene R46L variant is associated with lower plasma lipid levels and cardiovascular risk in healthy U.K. men.
17539906 2007 Multiplex ARMS analysis to detect 13 common mutations in familial hypercholesterolaemia.
17537735 2007 Catalytic activity is not required for secreted PCSK9 to reduce low density lipoprotein receptors in HepG2 cells.
17502100 2007 The crystal structure of PCSK9: a regulator of plasma LDL-cholesterol.
17495605 2007 Unravelling the functional significance of PCSK9.
17461796 2007 The cellular trafficking of the secretory proprotein convertase PCSK9 and its dependence on the LDLR.
17452316 2007 Binding of proprotein convertase subtilisin/kexin type 9 to epidermal growth factor-like repeat A of low density lipoprotein receptor decreases receptor recycling and increases degradation.
17449864 2007 Secreted PCSK9 downregulates low density lipoprotein receptor through receptor-mediated endocytosis.
17435765 2007 Structural and biophysical studies of PCSK9 and its mutants linked to familial hypercholesterolemia.
17391637 2007 [After the LDL receptor and apolipoprotein B, autosomal dominant hypercholesterolemia reveals its third protagonist: PCSK9].
17351764 2007 The proprotein convertases are potential targets in the treatment of dyslipidemia.
17328821 2007 Degradation of the LDL receptors by PCSK9 is not mediated by a secreted protein acted upon by PCSK9 extracellularly.
17316651 2008 Genetic variants in PCSK9 in the Japanese population: rare genetic variants in PCSK9 might collectively contribute to plasma LDL cholesterol levels in the general population.
17170371 2007 A novel loss of function mutation of PCSK9 gene in white subjects with low-plasma low-density lipoprotein cholesterol.
17142622 2006 Genetic causes of familial hypercholesterolaemia in patients in the UK: relation to plasma lipid levels and coronary heart disease risk.
17101087 2006 [PCSK9, from gene to protein: a new actor involved in cholesterol homeostasis].
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17080197 2006 Secreted PCSK9 decreases the number of LDL receptors in hepatocytes and in livers of parabiotic mice.
17051583 2006 Proapoptotic effects of NARC 1 (= PCSK9), the gene encoding a novel serine proteinase.
16989838 2007 The C679X mutation in PCSK9 is present and lowers blood cholesterol in a Southern African population.
16912035 2006 The proprotein convertase (PC) PCSK9 is inactivated by furin and/or PC5/6A: functional consequences of natural mutations and post-translational modifications.
16909389 2006 Molecular characterization of loss-of-function mutations in PCSK9 and identification of a compound heterozygote.
16875509 2006 The E670G SNP in the PCSK9 gene is associated with polygenic hypercholesterolemia in men but not in women.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16619215 2006 The c.43_44insCTG variation in PCSK9 is associated with low plasma LDL-cholesterol in a Caucasian population.
16571601 2006 Effect of mutations in the PCSK9 gene on the cell surface LDL receptors.
16554528 2006 Sequence variations in PCSK9, low LDL, and protection against coronary heart disease.
16465619 2006 A spectrum of PCSK9 alleles contributes to plasma levels of low-density lipoprotein cholesterol.
16407292 2006 Hepatic PCSK9 expression is regulated by nutritional status via insulin and sterol regulatory element-binding protein 1c.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314752 2005 No genetic association between PCSK9 polymorphisms and Alzheimer's disease and plasma cholesterol level in Japanese patients.
16224054 2005 Severe hypercholesterolemia in four British families with the D374Y mutation in the PCSK9 gene: long-term follow-up and treatment response.
16211558 2005 Novel mutations of the PCSK9 gene cause variable phenotype of autosomal dominant hypercholesterolemia.
16183066 2006 Additive effect of mutations in LDLR and PCSK9 genes on the phenotype of familial hypercholesterolemia.
16159606 2005 Genetic screening protocol for familial hypercholesterolemia which includes splicing defects gives an improved mutation detection rate.
15893176 2005 A common PCSK9 haplotype, encompassing the E670G coding single nucleotide polymorphism, is a novel genetic marker for plasma low-density lipoprotein cholesterol levels and severity of coronary atherosclerosis.
15772090 2005 Evidence for effect of mutant PCSK9 on apolipoprotein B secretion as the cause of unusually severe dominant hypercholesterolaemia.
15741654 2005 Wild-type PCSK9 inhibits LDL clearance but does not affect apoB-containing lipoprotein production in mouse and cultured cells.
15654334 2005 Low LDL cholesterol in individuals of African descent resulting from frequent nonsense mutations in PCSK9.
15358785 2004 NARC-1/PCSK9 and its natural mutants: zymogen cleavage and effects on the low density lipoprotein (LDL) receptor and LDL cholesterol.
15178557 2004 Statins upregulate PCSK9, the gene encoding the proprotein convertase neural apoptosis-regulated convertase-1 implicated in familial hypercholesterolemia.
15166014 2004 Apolipoprotein B100 metabolism in autosomal-dominant hypercholesterolemia related to mutations in PCSK9.
15099351 2004 Mutations in the PCSK9 gene in Norwegian subjects with autosomal dominant hypercholesterolemia.
14727179 2004 A mutation in PCSK9 causing autosomal-dominant hypercholesterolemia in a Utah pedigree.
14727156 2004 Genetic variants in PCSK9 affect the cholesterol level in Japanese.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14622975 2003 Functional characterization of Narc 1, a novel proteinase related to proteinase K.
12730697 2003 Mutations in PCSK9 cause autosomal dominant hypercholesterolemia.
12552133 2003 The secretory proprotein convertase neural apoptosis-regulated convertase 1 (NARC-1): liver regeneration and neuronal differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10205269 1999 A third major locus for autosomal dominant hypercholesterolemia maps to 1p34.1-p32.