Property Summary

NCBI Gene PubMed Count 70
PubMed Score 697.23
PubTator Score 369.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.400 4.8e-02
malignant mesothelioma -1.800 1.6e-06
psoriasis -1.100 2.9e-03
glioblastoma multiforme 1.300 1.0e-12
osteosarcoma -2.087 9.3e-03
astrocytoma 1.100 2.7e-02
medulloblastoma, large-cell -1.800 2.8e-02
Atopic dermatitis -1.500 1.5e-03
intraductal papillary-mucinous neoplasm ... 1.900 9.0e-03
lung cancer -2.100 7.2e-05
breast carcinoma -1.400 1.7e-03
posterior fossa group B ependymoma 1.100 7.9e-05
nasopharyngeal carcinoma -1.700 2.1e-07
spina bifida -1.641 3.4e-02
gastric carcinoma 2.400 3.5e-03
ductal carcinoma in situ -1.200 4.3e-02
invasive ductal carcinoma -2.600 9.7e-04
ovarian cancer -3.200 4.8e-09
pituitary cancer -1.100 4.0e-02
dermatomyositis 1.500 1.1e-02
head and neck cancer -1.100 4.0e-02

Protein-protein Interaction (1)

Gene RIF (33)

PMID Text
26077903 full-length alpha-DG in the human endometrial epithelium is a barrier for embryo attachment and that removal of alpha-DG-N by proprotein convertase 5/6 (PC6; a protease critical for implantation
26055999 Case Report: whole exome sequencing of a case with the VACTERL association uncovered a novel frameshift mutation in the PCSK5 gene.
25429785 Proprotein convertase 5/6 cleaves PDGFA in the human endometrium in preparation for embryo implantation.
25350918 PC5/6A is involved in squamous differentiation of human nasal epithelial cells, possibly through up-regulation of the BMP-2 signaling pathway.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of proprotein convertase subtilisin/kexin type 5 (PCSK5) in primary human brain microvascular endothelial cells
23686857 overexpression of PCs, furin and PC5, but not PC7, which are all expressed in SMC, increase PKGI cleavage in a dose-dependent manner
22740495 study implicates PC6 as a key regulatory protein essential for the attachment of the blastocyst to the endometrial epithelium through the processing of pro-integrin-alphas
21971156 PC6 plays a key role in regulating fundamental cellular remodeling processes, such as plasma membrane transformation and membrane-cytoskeletal interface reorganization.
21700711 Latent transforming growth factor beta-binding proteins-2 and -3 inhibit the proprotein convertase 5/6A.
21273245 PC6 may have a role in uterine receptivity and its uterine lavage levels appear to be significantly lower in a subgroup of women with unexplained infertility
21094132 PTPkappa was scissored by the processed form of proprotein convertase 5, and galectin-3 binding protein which is over-produced in colon cancer cells and tissues.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20555025 The proteolytic activation and thus bioavailability of BMP2 is controlled by PC6.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20031622 Variability at the PCSK5 locus influences high-density lipoprotein cholesterol levels.
20031622 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19884766 Microarray analysis indicates HIV-1 Tat-induced upregulation of proprotein convertase subtilisin/kexin type 5 (PCSK5) in primary human brain microvascular endothelial cells
19764806 Results describe the mechanisms of PC6 action in decidualization and identify caldesmon as one of its physiological substrates.
18519639 We propose that Pcsk5, at least in part via GDF11, coordinately regulates caudal Hox paralogs, to control anteroposterior patterning, nephrogenesis, skeletal, and anorectal development.
18245819 fibrates simultaneously decreased PCSK9 expression while increasing PC5/6A and furin expression, indicating a broad action of PPARalpha activation in proprotein convertase-mediated lipid homeostasis.
18096669 PC1/3 governs the endocrine and PC2 the neuronal processing of proCCK, whereas PC5/6 contributes only to a modest endocrine synthesis of CCK-22.
18061232 Microarray analysis indicates HIV-1 Tat-induced upregulation of proprotein convertase subtilisin/kexin type 5 (PCSK5) in primary human brain microvascular endothelial cells
18039650 after stimulation, the protease activity of PC5A is enhanced, as evidenced by the cleavage of the PC5A substrates Lefty, ADAMTS-4, endothelial lipase, and PCSK9.
17242158 in binding VEGFR-2, furin and PC5 promote cleavage of N-and C-terminal VEGF-D propeptides, whereas PC7 promotes cleavage of the C-terminal propeptide only
16912035 PCSK9 levels are finely regulated by the basic amino acid convertases furin and PC5/6A
15911696 furin and PC5 play a role in a MT-MMP-MMP-2 proteolytic cascade, involving provision of macrophage MT1-MMP for the activation of pro-MMP-2; furin and PC5 are expressed in monocytes and colocalize with MT1-MMP in macrophages in the atherosclerotic plaque
15601911 PC6 is an essential molecule in modulating uterine function to support the establishment of embryo implantation
15522936 PC5/6 plays a key role for decidualization in human endometrium.
11723118 we investigated the specificity and potency of complete prodomains and short C-terminal prodomain peptides of each SPC on highly purified, soluble enzyme preparations of human SPC1, SPC6, and SPC7.
11063880 Microarray analysis indicates HIV-1 Tat-induced upregulation of proprotein convertase subtilisin/kexin type 5 (PCSK5) in primary human brain microvascular endothelial cells
9521771 Microarray analysis indicates HIV-1 Tat-induced upregulation of proprotein convertase subtilisin/kexin type 5 (PCSK5) in primary human brain microvascular endothelial cells
8670066 Microarray analysis indicates HIV-1 Tat-induced upregulation of proprotein convertase subtilisin/kexin type 5 (PCSK5) in primary human brain microvascular endothelial cells

AA Sequence

MGWGSRCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEANRIASKYGFINIGQIGALKD      1 - 70
YYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSRAQSTYFNDPKWPSMWYMHCS     71 - 140
DNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNEN    141 - 210
KHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKT    211 - 280
VDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEE    281 - 350
CSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSR    351 - 420
AGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIRPNSAVRSIYK    421 - 490
ASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANRLFDHSMEGFKNWEFMTIHCW    491 - 560
GERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSVQPYSPTNEFPKVERFRYSRVEDPTDDYGTE    561 - 630
DYAGPCDPECSEVGCDGPGPDHCNDCLHYYYKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSH    631 - 700
GDQCMSCKYGYFLNEETNSCVTHCPDGSYQDTKKNLCRKCSENCKTCTEFHNCTECRDGLSLQGSRCSVS    701 - 770
CEDGRYFNGQDCQPCHRFCATCAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDI    771 - 840
SCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDGEYVDEHGHCQTCEASCAKCQGPTQEDCTTCPMTR    841 - 910
IFDDGRCVSNCPSWKFEFENQCHPCHHTCQRCQGSGPTHCTSCGADNYGREHFLYQGECGDSCPEGHYAT    911 - 980
EGNTCLPCPDNCELCHSVHVCTRCMKGYFIAPTNHTCQKLECGQGEVQDPDYEECVPCEEGCLGCSLDDP    981 - 1050
GTCTSCAMGYYRFDHHCYKTCPEKTYSEEVECKACDSNCGSCDQNGCYWCEEGFFLLGGSCVRKCGPGFY   1051 - 1120
GDQEMGECESCHRACETCTGPGHDECSSCQEGLQLLRGMCVHATKTQEEGKFWNDILRKLQPCHSSCKTC   1121 - 1190
NGSATLCTSCPKGAYLLAQACVSSCPQGTWPSVRSGSCENCTEACAICSGADLCKKCQMQPGHPLFLHEG   1191 - 1260
RCYSKCPEGSYAEDGICERCSSPCRTCEGNATNCHSCEGGHVLHHGVCQENCPERHVAVKGVCKHCPEMC   1261 - 1330
QDCIHEKTCKECTPEFFLHDDMCHQSCPRGFYADSRHCVPCHKDCLECSGPKADDCELCLESSWVLYDGL   1331 - 1400
CLEECPAGTYYEKETKECRDCHKSCLTCSSSGTCTTCQKGLIMNPRGSCMANEKCSPSEYWDEDAPGCKP   1401 - 1470
CHVKCFHCMGPAEDQCQTCPMNSLLLNTTCVKDCPEGYYADEDSNRCAHCHSSCRTCEGRHSRQCHSCRP   1471 - 1540
GWFQLGKECLLQCREGYYADNSTGRCERCNRSCKGCQGPRPTDCLSCDRFFFLLRSKGECHRSCPDHYYV   1541 - 1610
EQSTQTCERCHPTCDQCKGKGALNCLSCVWSYHLMGGICTSDCLVGEYRVGEGEKFNCEKCHESCMECKG   1611 - 1680
PGAKNCTLCPANLVLHMDDSHCLHCCNTSDPPSAQECCDCQDTTDECILRTSKVRPATEHFKTALFITSS   1681 - 1750
MMLVLLLGAAVVVWKKSRGRVQPAAKAGYEKLADPNKSYSSYKSSYRESTSFEEDQVIEYRDRDYDEDDD   1751 - 1820
DDIVYMGQDGTVYRKFKYGLLDDDDIDELEYDDESYSYYQ                                 1821 - 1860
//

Text Mined References (73)

PMID Year Title
26077903 2015 Posttranslational removal of ?-dystroglycan N terminus by PC5/6 cleavage is important for uterine preparation for embryo implantation in women.
26055999 2015 PCSK5 mutation in a patient with the VACTERL association.
25429785 2015 Proprotein convertase 5/6 cleaves platelet-derived growth factor A in the human endometrium in preparation for embryo implantation.
25416956 2014 A proteome-scale map of the human interactome network.
25350918 2015 Proprotein convertase 5/6a is associated with bone morphogenetic protein-2-induced squamous cell differentiation.
24252756 2013 Proprotein convertases in high-density lipoprotein metabolism.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
23686857 2013 Proprotein convertases play an important role in regulating PKGI endoproteolytic cleavage and nuclear transport.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23409034 2013 Alterations in gene expression of proprotein convertases in human lung cancer have a limited number of scenarios.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
22740495 2012 Cleavage of endometrial ?-integrins into their functional forms is mediated by proprotein convertase 5/6.
22679642 2012 The biology and therapeutic targeting of the proprotein convertases.
21971156 2011 Proprotein convertase 5/6 is critical for embryo implantation in women: regulating receptivity by cleaving EBP50, modulating ezrin binding, and membrane-cytoskeletal interactions.
21805237 2011 The proprotein convertases, 20 years later.
21805236 2011 The prohormone theory and the proprotein convertases: it is all about serendipity.
21700711 2011 Latent transforming growth factor beta-binding proteins-2 and -3 inhibit the proprotein convertase 5/6A.
21273245 2011 PC6 levels in uterine lavage are closely associated with uterine receptivity and significantly lower in a subgroup of women with unexplained infertility.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
21094132 2011 Galectin-3 binding protein promotes cell motility in colon cancer by stimulating the shedding of protein tyrosine phosphatase kappa by proprotein convertase 5.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20581395 2010 Angiopoietin-like protein 3 inhibits lipoprotein lipase activity through enhancing its cleavage by proprotein convertases.
20555025 2010 Posttranslational activation of bone morphogenetic protein 2 is mediated by proprotein convertase 6 during decidualization for pregnancy establishment.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20031622 2009 Genetic variation at the proprotein convertase subtilisin/kexin type 5 gene modulates high-density lipoprotein cholesterol levels.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19764806 2009 Proteomic identification of caldesmon as a physiological substrate of proprotein convertase 6 in human uterine decidual cells essential for pregnancy establishment.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18519639 2008 VACTERL/caudal regression/Currarino syndrome-like malformations in mice with mutation in the proprotein convertase Pcsk5.
18343183 2008 The activation and physiological functions of the proprotein convertases.
18245819 2008 Dual mechanisms for the fibrate-mediated repression of proprotein convertase subtilisin/kexin type 9.
18096669 2008 The cell-specific pattern of cholecystokinin peptides in endocrine cells versus neurons is governed by the expression of prohormone convertases 1/3, 2, and 5/6.
18039650 2008 The regulated cell surface zymogen activation of the proprotein convertase PC5A directs the processing of its secretory substrates.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17242158 2007 Proprotein convertases promote processing of VEGF-D, a critical step for binding the angiogenic receptor VEGFR-2.
16912035 2006 The proprotein convertase (PC) PCSK9 is inactivated by furin and/or PC5/6A: functional consequences of natural mutations and post-translational modifications.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15911696 2005 Furin-like proprotein convertases are central regulators of the membrane type matrix metalloproteinase-pro-matrix metalloproteinase-2 proteolytic cascade in atherosclerosis.
15606899 2005 Beta-amyloid protein converting enzyme 1 and brain-specific type II membrane protein BRI3: binding partners processed by furin.
15601911 2005 Inhibiting uterine PC6 blocks embryo implantation: an obligatory role for a proprotein convertase in fertility.
15522936 2005 Requirement for proprotein convertase 5/6 during decidualization of human endometrial stromal cells in vitro.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787574 2003 Neurotrophin secretion: current facts and future prospects.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11776387 2001 Single-nucleotide polymorphisms of the proprotein convertase subtilisin/ kexin type 5 (PCSK5) gene.
11723118 2002 Inhibitory potency and specificity of subtilase-like pro-protein convertase (SPC) prodomains.
11380615 2001 Proprotein convertase expression and localization in epidermis: evidence for multiple roles and substrates.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10900462 2000 The proprotein convertases furin and PACE4 play a significant role in tumor progression.
10888676 2000 Regulation of membrane type-1 matrix metalloproteinase activation by proprotein convertases.
10657249 2000 Endoproteolytic processing of integrin pro-alpha subunits involves the redundant function of furin and proprotein convertase (PC) 5A, but not paired basic amino acid converting enzyme (PACE) 4, PC5B or PC7.
10409610 1999 Proteolytic processing in the secretory pathway.
9067430 1996 Assignment of the human proprotein convertase gene PCSK5 to chromosome 9q21.3.
8947550 1996 The isoforms of proprotein convertase PC5 are sorted to different subcellular compartments.
8940009 1996 Identification of the paired basic convertases implicated in HIV gp160 processing based on in vitro assays and expression in CD4(+) cell lines.
8901832 1996 Prohormone convertase PC5 is a candidate processing enzyme for prorenin in the human adrenal cortex.
8755541 1996 Bioactivation of Müllerian inhibiting substance during gonadal development by a kex2/subtilisin-like endoprotease.
8755538 1996 Isolation of the human PC6 gene encoding the putative host protease for HIV-1 gp160 processing in CD4+ T lymphocytes.
8620001 1996 Increased proteolytic processing of protein tyrosine phosphatase mu in confluent vascular endothelial cells: the role of PC5, a member of the subtilisin family.
8615794 1996 Cellular processing of the nerve growth factor precursor by the mammalian pro-protein convertases.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7782070 1995 Chromosomal assignment of the genes for proprotein convertases PC4, PC5, and PACE 4 in mouse and human.