Property Summary

NCBI Gene PubMed Count 58
PubMed Score 107.02
PubTator Score 125.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -3.100 1.4e-03
oligodendroglioma -2.200 5.3e-11
cutaneous lupus erythematosus -2.000 2.1e-03
glioblastoma -3.300 2.4e-04
posterior fossa group B ependymoma -4.000 3.3e-14
group 4 medulloblastoma -3.600 1.3e-06
atypical teratoid / rhabdoid tumor -4.100 3.2e-12
medulloblastoma, large-cell -2.700 3.7e-03
primitive neuroectodermal tumor -2.600 2.3e-03
intraductal papillary-mucinous neoplasm ... -1.100 5.1e-03
pancreatic cancer -1.300 2.0e-02
adult high grade glioma -3.100 1.9e-05
pilocytic astrocytoma -3.100 9.9e-08
aldosterone-producing adenoma -1.666 2.8e-02
subependymal giant cell astrocytoma -3.515 5.0e-03
severe Alzheimer's disease -1.250 4.7e-02
lung carcinoma 2.900 1.3e-14
ovarian cancer -1.100 3.6e-05
pituitary cancer 2.600 6.6e-03

Gene RIF (22)

PMID Text
26607656 PCSK2 gene polymorphisms are associated with pleiotropic effects on various traits of glucose homeostasis and incident diabetes.
25811241 FAM20C plays a role in 7B2-mediated proPC2 activation by phosphorylating residue Thr111; and that 7B2 function is regulated by alternative splicing.
24226266 in the processing of hypothalamic neuropeptides in huntington disease may partially arise from decreased PC1/3 and PC2 expressions.
23011353 variant of the PCSK2 gene was associated with reduced glucose-stimulated insulin secretion, but also with lower glucagon levels, which could potentially counteract the effects of decreased insulin secretion on the risk of type 2 diabetes
21437630 The association of risk allele rs2021785 at PCSK2 with type 2 diabetes exists in a Han Chinese population
21383526 differential gene expression profiles revealed more abundant mRNA expression in ectopic ACTH syndrome than in Cushing disease of proprotein convertase-2
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20036365 SEMA3F, CLEC16A, LAMA3, and PCSK2 variants have roles in myocardial infarction in Japanese individuals
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Data revealed that six polymorphisms of F10, PITRM1, PCSK2, JPH3, MYO7B, and AKAP12 were related (P<0.05) to the prevalence of chronic kidney disease.
19724895 Observational study of gene-disease association. (HuGE Navigator)
19628676 The presence of PC and GOAT in the cells, as well as n-octanoic acid in the culture medium, was necessary to produce n-octanoyl ghrelin.
19339735 PC1 and PC2 were primarily expressed in neurons, whereas PACE4 appeared to be largely restricted to glia. Thus, elevated PACE4 may modulate the bioactivity of proteins secreted in the ONH and retina.
19260141 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18096669 PC1/3 governs the endocrine, and PC2 the neuronal processing, of proCCK, whereas PC5/6 contributes only to a modest endocrine synthesis of CCK-22.
17618154 Observational study of gene-disease association. (HuGE Navigator)
17618154 Single nucleotide polymorphisms in PCSK2 is associated with type 2 diabetes
16293189 PC1 and PC2 in are abnormally expressed and processed in human colorectal liver metastases
15585599 concluded that there are two novel TRE-like sequences in the hPC2 promoter and that these regions act in concert in a unique manner to facilitate the effects of thyroid hormone and 9-cis-retinoic acid on PC2
14614908 A marked decrease in the ratio of the PC2 precursor to the total enzymatic pool is observed in the frontal cortex of Alzheimer patients; however, the content and enzymatic activity of the PC2 mature form are similar in Alzheimer patients and controls.
11720250 prominently expressed in PTHrP-expressing human cancer cell lines originating from tumors of the breast, lung, prostate, as well as lymphoma

AA Sequence

MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFY      1 - 70
HNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADG     71 - 140
TPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGT    141 - 210
RCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDG    211 - 280
PRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSST    281 - 350
LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN    351 - 420
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLT    421 - 490
TDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTW    491 - 560
GEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEELEEELDEAVERS    561 - 630
LKSILNKN                                                                  631 - 638
//

Text Mined References (60)

PMID Year Title
26607656 2015 Genetic polymorphisms of PCSK2 are associated with glucose homeostasis and progression to type 2 diabetes in a Chinese population.
25811241 2015 Phosphorylation and Alternative Splicing of 7B2 Reduce Prohormone Convertase 2 Activation.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24839885 2014 A genome-wide association meta-analysis of preschool internalizing problems.
24226266 2013 Decreased hypothalamic prohormone convertase expression in huntington disease patients.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23011353 2012 Effect of a common variant of the PCSK2 gene on reduced insulin secretion.
22679642 2012 The biology and therapeutic targeting of the proprotein convertases.
21805237 2011 The proprotein convertases, 20 years later.
21805236 2011 The prohormone theory and the proprotein convertases: it is all about serendipity.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
21437630 2012 Association of type 2 diabetes susceptibility genes (TCF7L2, SLC30A8, PCSK1 and PCSK2) and proinsulin conversion in a Chinese population.
21383526 2011 Differential gene expression profiles of POMC-related enzymes, transcription factors and receptors between non-pituitary and pituitary ACTH-secreting tumors.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20501680 2010 Possible relevance between prohormone convertase 2 expression and tumor growth in human adrenocorticotropin-producing pituitary adenoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20036365 2010 Association of genetic variants in SEMA3F, CLEC16A, LAMA3, and PCSK2 with myocardial infarction in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19628676 2009 Production of n-octanoyl-modified ghrelin in cultured cells requires prohormone processing protease and ghrelin O-acyltransferase, as well as n-octanoic acid.
19339735 2009 Subtilisin-like proprotein convertase expression, localization, and activity in the human retina and optic nerve head.
19260141 2009 Genome-wide association study of biochemical traits in Korcula Island, Croatia.
18343183 2008 The activation and physiological functions of the proprotein convertases.
18096669 2008 The cell-specific pattern of cholecystokinin peptides in endocrine cells versus neurons is governed by the expression of prohormone convertases 1/3, 2, and 5/6.
17618154 Association of the proprotein convertase subtilisin/kexin-type 2 (PCSK2) gene with type 2 diabetes in an African American population.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16293189 2005 Abnormal expression and processing of the proprotein convertases PC1 and PC2 in human colorectal liver metastases.
15585599 2005 Regulation of regional expression in rat brain PC2 by thyroid hormone/characterization of novel negative thyroid hormone response elements in the PC2 promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14614908 2003 The proprotein convertase PC2 is involved in the maturation of prosomatostatin to somatostatin-14 but not in the somatostatin deficit in Alzheimer's disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11720250 2001 Comparative tissue distribution of the processing enzymes "prohormone thiol protease," and prohormone convertases 1 and 2, in human PTHrP-producing cell lines and mammalian neuroendocrine tissues.
11439082 2001 Neuroendocrine secretory protein 7B2: structure, expression and functions.
11246872 2001 The prohormone convertase enzyme 2 (PC2) is essential for processing pro-islet amyloid polypeptide at the NH2-terminal cleavage site.
10931181 2000 Processing of synthetic pro-islet amyloid polypeptide (proIAPP) 'amylin' by recombinant prohormone convertase enzymes, PC2 and PC3, in vitro.
10900462 2000 The proprotein convertases furin and PACE4 play a significant role in tumor progression.
10530621 1999 Immunohistochemical expressions of prohormone convertase (PC)1/3 and PC2 in carcinoids of various organs.
10409610 1999 Proteolytic processing in the secretory pathway.
9467579 1998 Attenuation of the polypeptide 7B2, prohormone convertase PC2, and vasopressin in the hypothalamus of some Prader-Willi patients: indications for a processing defect.
9359835 1997 Regulation of human prohormone convertase 2 promoter activity by the transcription factor EGR-1.
9287128 1997 Role of the prohormone convertase PC2 in the processing of proglucagon to glucagon.
9020868 1997 Mutations within the propeptide, the primary cleavage site or the catalytic site, or deletion of C-terminal sequences, prevents secretion of proPC2 from transfected COS-7 cells.
8661740 1996 Radiation hybrid mapping of SNAP, PCSK2, and THBD (human chromosome 20p).
8557106 1996 Processing of pro-islet amyloid polypeptide (proIAPP) by the prohormone convertase PC2.
8276855 1994 Autocatalytic maturation of the prohormone convertase PC2.
8034613 1994 Calcium- and pH-dependent aggregation and membrane association of the precursor of the prohormone convertase PC2.
7983775 1994 [Analysis of the gene encoding human PC2, a prohormone processing enzyme].
7913882 1994 7B2 is a neuroendocrine chaperone that transiently interacts with prohormone convertase PC2 in the secretory pathway.
7836407 1995 Differences in pH optima and calcium requirements for maturation of the prohormone convertases PC2 and PC3 indicates different intracellular locations for these events.
7722516 1995 7B2 is a specific intracellular binding protein of the prohormone convertase PC2.
7626024 1995 Differences between the catalytic properties of recombinant human PC2 and endogenous rat PC2.
3053705 1988 An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.
2154467 1990 Identification of a human insulinoma cDNA encoding a novel mammalian protein structurally related to the yeast dibasic processing protease Kex2.
1765368 1991 Chromosomal assignments of the genes for neuroendocrine convertase PC1 (NEC1) to human 5q15-21, neuroendocrine convertase PC2 (NEC2) to human 20p11.1-11.2, and furin (mouse 7[D1-E2] region).
1594602 1992 Identification and analysis of the gene encoding human PC2, a prohormone convertase expressed in neuroendocrine tissues.