Property Summary

Ligand Count 4
NCBI Gene PubMed Count 59
PubMed Score 109.79
PubTator Score 125.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -3.100 1.9e-05
aldosterone-producing adenoma -1.666 2.8e-02
astrocytic glioma -3.100 1.4e-03
Astrocytoma, Pilocytic -3.200 2.2e-08
atypical teratoid / rhabdoid tumor -4.100 3.2e-12
cutaneous lupus erythematosus -2.000 2.1e-03
ependymoma -3.700 2.1e-15
glioblastoma -3.000 4.0e-07
group 4 medulloblastoma -3.600 1.3e-06
intraductal papillary-mucinous neoplasm ... -1.100 5.1e-03
lung carcinoma 2.900 1.3e-14
medulloblastoma, large-cell -2.700 3.7e-03
oligodendroglioma -1.800 4.1e-02
ovarian cancer -1.100 3.6e-05
pancreatic cancer -1.300 2.0e-02
pituitary cancer 2.600 6.6e-03
primitive neuroectodermal tumor -2.600 2.3e-03
severe Alzheimer's disease -1.250 4.7e-02
subependymal giant cell astrocytoma -3.515 5.0e-03

Gene RIF (22)

AA Sequence

MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDKARQVAAEHGFGVRKLPFAEGLYHFY      1 - 70
HNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQADG     71 - 140
TPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPRYTDDWFNSHGT    141 - 210
RCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDG    211 - 280
PRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSST    281 - 350
LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN    351 - 420
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLT    421 - 490
TDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTW    491 - 560
GEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEELEEELDEAVERS    561 - 630
LKSILNKN                                                                  631 - 638
//

Text Mined References (61)

PMID Year Title