Property Summary

NCBI Gene PubMed Count 37
PubMed Score 292.60
PubTator Score 31.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -1.500 1.3e-02
malignant mesothelioma -2.600 5.2e-07
astrocytoma -3.900 1.1e-03
ependymoma -3.800 6.0e-18
oligodendroglioma -3.000 2.1e-20
psoriasis -1.400 1.2e-03
glioblastoma -4.400 1.3e-05
sonic hedgehog group medulloblastoma -3.000 3.5e-05
atypical teratoid / rhabdoid tumor -4.700 1.1e-12
medulloblastoma, large-cell -3.200 1.2e-06
primitive neuroectodermal tumor -2.400 1.9e-04
interstitial cystitis -1.800 3.6e-06
pediatric high grade glioma -3.800 1.9e-08
pilocytic astrocytoma -4.300 9.8e-13
subependymal giant cell astrocytoma -2.553 4.8e-02
lung carcinoma 3.100 1.2e-41
Pick disease -1.800 3.9e-02
ovarian cancer -1.900 4.4e-09

Gene RIF (28)

PMID Text
26391493 Results provide some support for the involvement of BICC1 and PCLO in late-life depressive disorders and preliminary evidence that these genetic variants may also influence brain structural volumes
26045179 Study created and characterized a knock-in mouse model carrying the PCLO Ser to Ala missense variant rs2522833, which has shown suggestive association with major depressive disorder in human population studies
25832664 A homozygous, nonsense PCLO mutation underlies the autosomal recessive neurodegenerative disorder pontocerebellar hypoplasia type III.
25817861 PCLO intron rs13438494 is associated with drug abuse and contributes to the pathogenesis of psychiatric disorders via modulation of neurotransmitter turnover.
25636086 The subsequent validation study on 68 LCBs identified recurrent mutations in TERT promoter, chromatin regulators (BAP1, PBRM1 and ARID2), a synapse organization gene (PCLO), IDH genes and KRAS.
25496667 Genome-wide shRNA screening identifies PCLO, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25379724 PCLO risk allele carrying remitted depressed patients did not show more negatively biased memory than non-risk allele carriers, not even patients with stressful childhood events.
24643163 PCLO and CACNA1C depression risk alleles jointly affect memory-related subgenual cingulate activity.
24278217 For neither PCLO nor GRM7 we found a more associated variant. For SLC6A4, we found a new SNP that showed a lower P-value than in the GAIN-MDD GWAS
24167553 The results demonstrate that rs13438494 intron 24 of PCLO gene alters the splicing efficiency by creating or disrupting a splicing motif that functions by binding of the splicing regulatory protein and may ultimately influence bipolar disorder.
23620758 The role of the PCLO risk allele on functional magnetic resonance imaging (MRI) correlates of emotional memory in a sample of 89 major depressive disorder patients, was investigated.
22832909 The PCLO risk allele was found to be specifically associated with altered emotion processing, but not with executive dysfunction. Moreover, the PCLO risk allele appears to modulate amygdala function during fearful facial processing.
22832399 Single-nucleotide polymorphism rs2522833 within the PCLO gene might increase vulnerability to major depression both by physiological and behavioral pathways.
22293360 In this study, the genotype distributions and allele frequencies of PCLO rs2522833 polymorphisms were examined in 267 Japanese healthy subjects
21621269 In major depressive disorder genome-wide association study, best femalee-specific SNP was rs2715148 within PCLO gene
21185011 one SNP (rs13438494), in an intron of the piccolo gene, was significantly associated with bipolar disorder
20980930 Piccolo transgenic mice exhibit depression-like behavior in forced swim and tail suspension tests, which may suggest that a single nucleotide polymorphism in the piccolo C2A domain may be a causal risk factor for major depression.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20567237 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20351715 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19942622 PCLO is associated with depressive disorders in a population-based study.
19942622 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19546850 The PCLO/Piccolo of SNPs(rs2522833)is a potentially causal variant in a biologically plausible candidate gene, with major depressive disorder.
19065144 From this GWAS results for the PCLO region were intriguing, this highly plausible hypothesis did not find support in a large-scale replication attempt.
19065144 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18647954 Variation within PCLO may have a modest effect on early-onset type 2 diabetes, possibly as a result of reduced insulin action, but has minimal, if any, impact on population-based risk for type 2 diabetes.

AA Sequence

MGNEASLEGEGLPEGLAAAAAAGGGASGAGSPSHTAIPAGMEADLSQLSEEERRQIAAVMSRAQGLPKGS      1 - 70
VPPAAAESPSMHRKQELDSSHPPKQSGRPPDPGRPAQPGLSKSRTTDTFRSEQKLPGRSPSTISLKESKS     71 - 140
RTDLKEEHKSSMMPGFLSEVNALSAVSSVVNKFNPFDLISDSEASQEETTKKQKVVQKEQGKPEGIIKPP    141 - 210
LQQQPPKPIPKQQGPGRDPLQQDGTPKSISSQQPEKIKSQPPGTGKPIQGPTQTPQTDHAKLPLQRDASR    211 - 280
PQTKQADIVRGESVKPSLPSPSKPPIQQPTPGKPPAQQPGHEKSQPGPAKPPAQPSGLTKPLAQQPGTVK    281 - 350
PPVQPPGTTKPPAQPLGPAKPPAQQTGSEKPSSEQPGPKALAQPPGVGKTPAQQPGPAKPPTQQVGTPKP    351 - 420
LAQQPGLQSPAKAPGPTKTPVQAKPPSQQPGSTKPPPQQPGPAKPSPQQPGSTKPPSQQPGSAKPSAQQP    421 - 490
SPAKPSAQQSTKPVSQTGSGKPLQPPTVSPSAKQPPSQGLPKTICPLCNTTELLLHVPEKANFNTCTECQ    491 - 560
TTVCSLCGFNPNPHLTEVKEWLCLNCQMKRALGGDLAPVPSSPQPKLKTAPVTTTSAVSKSSPQPQQTSP    561 - 630
KKDAAPKQDLSKAPEPKKPPPLVKQPTLHGSPSAKAKQPPEADSLSKPAPPKEPSVPSEQDKAPVADDKP    631 - 700
KQPKMVKPTTDLVSSSSATTKPDIPSSKVQSQAEEKTTPPLKTDSAKPSQSFPPTGEKVSPFDSKAIPRP    701 - 770
ASDSKIISHPGPSSESKGQKQVDPVQKKEEPKKAQTKMSPKPDAKPMPKGSPTPPGPRPTAGQTVPTPQQ    771 - 840
SPKPQEQSRRFSLNLGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPGPHSQSGPGAPM    841 - 910
KQAPAPSQPPTSQGPPKSTGQAPPAPAKSIPVKKETKAPAAEKLEPKAEQAPTVKRTETEKKPPPIKDSK    911 - 980
SLTAEPQKAVLPTKLEKSPKPESTCPLCKTELNIGSKDPPNFNTCTECKNQVCNLCGFNPTPHLTENCQT    981 - 1050
QRAISGQLGDIRKMPPAPSGPKASPMPVPTESSSQKTAVPPQVKLVKKQEQEVKTEAEKVILEKVKETLS   1051 - 1120
MEKIPPMVTTDQKQEESKLEKDKASALQEKKPLPEEKKLIPEEEKIRSEEKKPLLEEKKPTPEDKKLLPE   1121 - 1190
AKTSAPEEQKHDLLKSQVQIAEEKLEGRVAPKTVQEGKQPQTKMEGLPSGTPQSLPKEDDKTTKTIKEQP   1191 - 1260
QPPCTAKPDQEKEDDKSDTSSSQQPKSPQGLSDTGYSSDGISSSLGEIPSLIPTDEKDILKGLKKDSFSQ   1261 - 1330
ESSPSSPSDLAKLESTVLSILEAQASTLADEKSEKKTQPHEVSPEQPKDQEKTQSLSETLEITISEEEIK   1331 - 1400
ESQEERKDTFKKDSQQDIPSSKDHKEKSEFVDDITTRREPYDSVEESSESENSPVPQRKRRTSVGSSSSD   1401 - 1470
EYKQEDSQGSGEEEDFIRKQIIEMSADEDASGSEDDEFIRNQLKEISSSTESQKKEETKGKGKITAGKHR   1471 - 1540
RLTRKSSTSIDEDAGRRHSWHDEDDEAFDESPELKYRETKSQESEELVVTGGGGLRRFKTIELNSTIADK   1541 - 1610
YSAESSQKKTSLYFDEEPELEMESLTDSPEDRSRGEGSSSLHASSFTPGTSPTSVSSLDEDSDSSPSHKK   1611 - 1680
GESKQQRKARHRPHGPLLPTIEDSSEEEELREEEELLKEQEKQREIEQQQRKSSSKKSKKDKDELRAQRR   1681 - 1750
RERPKTPPSNLSPIEDASPTEELRQAAEMEELHRSSCSEYSPSIESDPEGFEISPEKIIEVQKVYKLPTA   1751 - 1820
VSLYSPTDEQSIMQKEGSQKALKSAEEMYEEMMHKTHKYKAFPAANERDEVFEKEPLYGGMLIEDYIYES   1821 - 1890
LVEDTYNGSVDGSLLTRQEEENGFMQQKGREQKIRLSEQIYEDPMQKITDLQKEFYELESLHSVVPQEDI   1891 - 1960
VSSSFIIPESHEIVDLGTMVTSTEEERKLLDADAAYEELMKRQQMQLTPGSSPTQAPIGEDMTESTMDFD   1961 - 2030
RMPDASLTSSVLSGASLTDSTSSATLSIPDVKITQHFSTEEIEDEYVTDYTREIQEIIAHESLILTYSEP   2031 - 2100
SESATSVPPSDTPSLTSSVSSVCTTDSSSPITTLDSITTVYTEPVDMITKFEDSEEISSSTYFPGSIIDY   2101 - 2170
PEEISVSLDRTAPPDGRASADHIVISLSDMASSIIESVVPKPEGPVADTVSTDLLISEKDPVKKAKKETG   2171 - 2240
NGIILEVLEAYRDKKELEAERTKSSLSETVFDHPPSSVIALPMKEQLSTTYFTSGETFGQEKPASQLPSG   2241 - 2310
SPSVSSLPAKPRPFFRSSSLDISAQPPPPPPPPPPPPPPPPPPPPPPLPPPTSPKPTILPKKKLTVASPV   2311 - 2380
TTATPLFDAVTTLETTAVLRSNGLPVTRICTTAPPPVPPKPSSIPSGLVFTHRPEPSKPPIAPKPVIPQL   2381 - 2450
PTTTQKPTDIHPKPTGLSLTSSMTLNLVTSADYKLPSPTSPLSPHSNKSSPRFSKSLTETYVVITLPSEP   2451 - 2520
GTPTDSSASQAITSWPLGSPSKDLVSVEPVFSVVPPVTAVEIPISSEQTFYISGALQTFSATPVTAPSSF   2521 - 2590
QAAPTSVTQFLTTEVSKTEVSATRSTAPSVGLSSISITIPPEPLALDNIHLEKPQYKEDGKLQLVGDVID   2591 - 2660
LRTVPKVEVKTTDKCIDLSASTMDVKRQITANEVYGKQISAVQPSIINLSVTSSIVTPVSLATETVTFVT   2661 - 2730
CTASASYTTGTESLVGAEHAMTTPLQLTTSKHAEPPYRIPSDQVFPIAREEAPINLSLGTPAHAVTLAIT   2731 - 2800
KPVTVPPVGVTNGWTDSTVSQGITDGEVVDLSTTKSHRTVVTMDESTSSVMTKIIEDEKPVDLTAGRRAV   2801 - 2870
CCDVVYKLPFGRSCTAQQPATTLPEDRFGYRDDHYQYDRSGPYGYRGIGGMKPSMSDTNLAEAGHFFYKS   2871 - 2940
KNAFDYSEGTDTAVDLTSGRVTTGEVMDYSSKTTGPYPETRQVISGAGISTPQYSTARMTPPPGPQYCVG   2941 - 3010
SVLRSSNGVVYSSVATPTPSTFAITTQPGSIFSTTVRDLSGIHTADAVTSLPAMHHSQPMPRSYFITTGA   3011 - 3080
SETDIAVTGIDISASLQTITMESLTAETIDSVPTLTTASEVFPEVVGDESALLIVPEEDKQQQQLDLERE   3081 - 3150
LLELEKIKQQRFAEELEWERQEIQRFREQEKIMVQKKLEELQSMKQHLLFQQEEERQAQFMMRQETLAQQ   3151 - 3220
QLQLEQIQQLQQQLHQQLEEQKIRQIYQYNYDPSGTASPQTTTEQAILEGQYAALEGSQFWATEDATTTA   3221 - 3290
SAVVAIEIPQSQGWYTVQSDGVTQYIAPPGILSTVSEIPLTDVVVKEEKQPKKRSSGAKVRGQYDDMGEN   3291 - 3360
MTDDPRSFKKIVDSGVQTDDEDATDRSYVSRRRRTKKSVDTSVQTDDEDQDEWDMPTRSRRKARVGKYGD   3361 - 3430
SMTEADKTKPLSKVSSIAVQTVAEISVQTEPVGTIRTPSIRARVDAKVEIIKHISAPEKTYKGGSLGCQT   3431 - 3500
EADSDTQSPQYLSATSPPKDKKRPTPLEIGYSSHLRADSTVQLAPSPPKSPKVLYSPISPLSPGKALESA   3501 - 3570
FVPYEKPLPDDISPQKVLHPDMAKVPPASPKTAKMMQRSMSDPKPLSPTADESSRAPFQYTEGYTTKGSQ   3571 - 3640
TMTSSGAQKKVKRTLPNPPPEEISTGTQSTFSTMGTVSRRRICRTNTMARAKILQDIDRELDLVERESAK   3641 - 3710
LRKKQAELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERAYLQGVAEDRDYMSDSEVSSTRPTRIES   3711 - 3780
QHGIERPRTAPQTEFSQFIPPQTQTESQLVPPTSPYTQYQYSSPALPTQAPTSYTQQSHFEQQTLYHQQV   3781 - 3850
SPYQTQPTFQAVATMSFTPQVQPTPTPQPSYQLPSQMMVIQQKPRQTTLYLEPKITSNYEVIRNQPLMIA   3851 - 3920
PVSTDNTFAVSHLGSKYNSLDLRIGLEERSSMASSPISSISADSFYADIDHHTPRNYVLIDDIGEITKGT   3921 - 3990
AALSTAFSLHEKDLSKTDRLLRTTETRRSQEVTDFLAPLQSSSRLHSYVKAEEDPMEDPYELKLLKHQIK   3991 - 4060
QEFRRGTESLDHLAGLSHYYHADTSYRHFPKSEKYSISRLTLEKQAAKQLPAAILYQKQSKHKKSLIDPK   4061 - 4130
MSKFSPIQESRDLEPDYSSYMTSSTSSIGGISSRARLLQDDITFGLRKNITDQQKFMGSSLGTGLGTLGN   4131 - 4200
TIRSALQDEADKPYSSGSRSRPSSRPSSVYGLDLSIKRDSSSSSLRLKAQEAEALDVSFSHASSSARTKP   4201 - 4270
TSLPISQSRGRIPIVAQNSEEESPLSPVGQPMGMARAAAGPLPPISADTRDQFGSSHSLPEVQQHMREES   4271 - 4340
RTRGYDRDIAFIMDDFQHAMSDSEAYHLRREETDWFDKPRESRLENGHGLDRKLPERLVHSRPLSQHQEQ   4341 - 4410
IIQMNGKTMHYIFPHARIKITRDSKDHTVSMQVLEWNGIPLTSKTYEEVQSIISQQSGEAEICVRLDLNM   4411 - 4480
LSDSENSQHLELHEPPKAVDKAKSPGVDPKQLAAELQKVSLQQSPLVLSSVVEKGSHVHSGPTSAGSSSV   4481 - 4550
PSPGQPGSPSVSKKKHGSSKLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGAEYKRRTK   4551 - 4620
HVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQ   4621 - 4690
TESIDHGKSHSSQSSQQSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRS   4691 - 4760
QSKTSVTQTHLEDAGAAIAAAEAAVQQLRIQPTAHKSGQSNHARKQHRHSIAGVLPIQRTQSDNLPPPAN   4761 - 4830
GNQDQSQLALRKVMSDGPVKPEGAKPPNHRPAESSVSTGSSGSSFGSGYSVDSEGSSSTAGETNLFPIPR   4831 - 4900
IGKMGQNGQEPVKQPGVGVGLADTEAKTQVMGEIKIALKKEMKTDGEQLIVEILQCRNITYKFKSPDHLP   4901 - 4970
DLYVKIYVMNISTQKKVIKKKTRVCRHDREPSFNETFRFSLSPAGHSLQILLFSNGGKFMKKTLIGEACI   4971 - 5040
WLDKVDLRKRIVNWHKLLVSPTQTH                                                5041 - 5065
//

Text Mined References (37)

PMID Year Title
26391493 2016 GWAS-identified risk variants for major depressive disorder: Preliminary support for an association with late-life depressive symptoms and brain structural alterations.
26045179 2015 Functional characterization of the PCLO p.Ser4814Ala variant associated with major depressive disorder reveals cellular but not behavioral differences.
25832664 2015 Loss of PCLO function underlies pontocerebellar hypoplasia type III.
25817861 2015 The Piccolo Intronic Single Nucleotide Polymorphism rs13438494 Regulates Dopamine and Serotonin Uptake and Shows Associations with Dependence-Like Behavior in Genomic Association Study.
25636086 2015 Whole-genome mutational landscape of liver cancers displaying biliary phenotype reveals hepatitis impact and molecular diversity.
25379724 2014 No evidence for the association between a polymorphism in the PCLO depression candidate gene with memory bias in remitted depressed patients and healthy individuals.
24643163 2014 Epistatic interaction of genetic depression risk variants in the human subgenual cingulate cortex during memory encoding.
24278217 2013 Resequencing three candidate genes for major depressive disorder in a Dutch cohort.
24167553 2013 Functional analysis of deep intronic SNP rs13438494 in intron 24 of PCLO gene.
23620758 2013 Modulatory effects of the piccolo genotype on emotional memory in health and depression.
22832909 2012 Piccolo genotype modulates neural correlates of emotion processing but not executive functioning.
22832399 2011 PCLO rs2522833 impacts HPA system activity in healthy young adults.
22293360 2012 Genotype distributions and allele frequencies of possible major depressive disorder-associated single nucleotide polymorphisms, cyclic adenosine monophosphate response element binding protein 1 rs4675690 and Piccolo rs2522833, in a Japanese population.
21621269 2011 Genome-wide association analysis of gender differences in major depressive disorder in the Netherlands NESDA and NTR population-based samples.
21185011 2011 Gene expression and genetic variation data implicate PCLO in bipolar disorder.
20980930 2010 Overexpression of piccolo C2A domain induces depression-like behavior in mice.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20567237 2011 Genetic risk profiles for depression and anxiety in adult and elderly cohorts.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20351715 2011 Meta-analysis of genome-wide association data of bipolar disorder and major depressive disorder.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19942622 2010 The PCLO gene and depressive disorders: replication in a population-based study.
19546850 2009 Joint reanalysis of 29 correlated SNPs supports the role of PCLO/Piccolo as a causal risk factor for major depressive disorder.
19065144 2009 Genome-wide association for major depressive disorder: a possible role for the presynaptic protein piccolo.
18647954 2008 PCLO variants are nominally associated with early-onset type 2 diabetes and insulin resistance in Pima Indians.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217342 2004 The synaptic vesicle cycle.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175852 Gene structure and genetic localization of the PCLO gene encoding the presynaptic active zone protein Piccolo.
10707984 2000 Piccolo, a presynaptic zinc finger protein structurally related to bassoon.
10508862 1999 Aczonin, a 550-kD putative scaffolding protein of presynaptic active zones, shares homology regions with Rim and Bassoon and binds profilin.
9847074 1998 Toward a complete human genome sequence.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8900486 1996 Piccolo, a novel 420 kDa protein associated with the presynaptic cytomatrix.