Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.21
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.700 6.8e-04
atypical teratoid / rhabdoid tumor 3.600 4.9e-10
glioblastoma 1.500 2.4e-04
group 3 medulloblastoma 1.300 1.2e-02
lung carcinoma 1.200 9.9e-10
ovarian cancer 1.600 6.6e-03
posterior fossa group A ependymoma 1.500 3.5e-04
primitive neuroectodermal tumor 2.300 1.6e-03

AA Sequence

MEAGEGKERVPKQRQVLIFFVLLGIAQASCQPRHYSVAEETESGSFVANLLKDLGLEIGELAVRGARVVS      1 - 70
KGKKMHLQFDRQTGDLLLNEKLDREELCGPTEPCVLPFQVLLENPLQFFQAELRIRDVNDHSPVFLDKEI     71 - 140
LLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNFHFHLNLQDSLDGIILPQLVLNRALDREEQPEI    141 - 210
RLTLTALDGGSPPRSGTALVRIEVVDINDNVPEFAKLLYEVQIPEDSPVGSQVAIVSARDLDIGTNGEIS    211 - 280
YAFSQASEDIRKTFRLSAKSGELLLRQKLDFESIQTYTVNIQATDGGGLSGTCVVFVQVMDLNDNPPELT    281 - 350
MSTLINQIPENLQDTLIAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVENFYTLVISTALDRETRSEYN    351 - 420
ITITVTDFGTPRLKTEHNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTY    421 - 490
SLLPPQDPHLPLASLVSINADNGHLFALQSLDYEALQAFEFRVGAADRGSPALSSEALVRVLVLDANDNS    491 - 560
PFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTAR    561 - 630
LLRERDAAKQRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLLLPEAAPAQAQADLLTVYLVVALASVS    631 - 700
SLFLFSVLLFVAVRLCRRSRAASVGRCSVPEGPFPGQMVDVSGTGTLSQSYQYEVCLTGGSGTNEFKFLK    701 - 770
PIIPNFVAQGAERVSEANPSFRKSFEFT                                              771 - 798
//

Text Mined References (12)

PMID Year Title