Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.33
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.435 2.2e-06
tuberculosis 1.100 1.1e-04
cystic fibrosis -1.300 1.4e-05
posterior fossa group B ependymoma 1.400 6.9e-08
ovarian cancer -1.400 4.8e-07

Synonym

Accession Q9H0N5 Q8TD40 PHS 2
Symbols PHS2
DCOH2
DCOHM

Gene

PANTHER Protein Class (2)

PDB

4C45  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12646162 PMID: 12646162 concludes Alu repeats interfere with splicing of DCOHM and CAVL such that transcripts containing exons of both genes exist.

AA Sequence

MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNF      1 - 70
NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV               71 - 130
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23568457 2013 Genetic variants associated with disordered eating.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15546961 2005 Novel interaction partners of the TPR/MET tyrosine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15182178 2004 Biochemical and structural basis for partially redundant enzymatic and transcriptional functions of DCoH and DCoH2.
12646162 2003 Cloning of a novel one-repeat calcium channel-like gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980910 2002 Mirk protein kinase is activated by MKK3 and functions as a transcriptional activator of HNF1alpha.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.