Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.67
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 416 6.9e-08
ovarian cancer 8520 4.8e-07
osteosarcoma 7950 2.2e-06
cystic fibrosis 1696 1.4e-05
tuberculosis 2010 1.1e-04
Disease Target Count Z-score Confidence
maturity-onset diabetes of the young 32 3.519 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis -1.300 1.4e-05
osteosarcoma -2.435 2.2e-06
ovarian cancer -1.400 4.8e-07
posterior fossa group B ependymoma 1.400 6.9e-08
tuberculosis 1.100 1.1e-04

Gene RIF (2)

AA Sequence

MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNF      1 - 70
NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV               71 - 130
//

Text Mined References (18)

PMID Year Title