Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.88
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q9BVG4
Symbols CXorf26

Gene

  Ortholog (3)

AA Sequence

MAATSGTDEPVSGELVSVAHALSLPAESYGNDPDIEMAWAMRAMQHAEVYYKLISSVDPQFLKLTKVDDQ      1 - 70
IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRI     71 - 140
QFFAIEIARNREGYNKAVYISVQDKEGEKGVNNGGEKRADSGEEENTKNGGEKGADSGEEKEEGINREDK    141 - 210
TDKGGEKGKEADKEINKSGEKAM                                                   211 - 233
//

Text Mined References (13)

PMID Year Title