Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.84
PubTator Score 7.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.3e-05
Breast cancer 3.400 2.9e-02
glioblastoma 1.200 3.2e-06
group 4 medulloblastoma 1.100 1.9e-03
medulloblastoma, large-cell 1.300 3.0e-05
osteosarcoma 1.904 4.9e-07
ovarian cancer 1.100 1.4e-04
pancreatic cancer 1.300 8.3e-03
pediatric high grade glioma 1.100 4.2e-05
primary pancreatic ductal adenocarcinoma 1.083 4.9e-03

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MFRYESLEDCPLDEDEDAFQGLGEEDEEIDQFNDDTFGSGAVDDDWQEAHERLAELEEKLPVAVNEQTGN      1 - 70
GERDEMDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQPQPGSLNSSIWDGSEVLRRIRGPLL     71 - 140
AQEMPTVSVLEYALPQRPPQGPEDDRDLSERALPRRSTSPIIGSPPVRAVPIGTPPKQMAVPSFTQQILC    141 - 210
PKPVHVRPPMPPRYPAPYGERMSPNQLCSVPNSSLLGHPFPPSVPPVLSPLQRAQLLGGAQLQPGRMSPS    211 - 280
QFARVPGFVGSPLAAMNPKLLQGRVGQMLPPAPGFRAFFSAPPSATPPPQQHPPGPGPHLQNLRSQAPMF    281 - 350
RPDTTHLHPQHRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQ    351 - 420
LQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKERTKLITPQVAKLEHAYKPVQFEGSLGKLTVSSV    421 - 490
NNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYERRYLLSLEEERPALMDDRKH    491 - 560
KICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMTTARNLPFLIKKDAQD    561 - 630
EVLPCLLSPFSLLLYHLPSVSITSLLRQLMNLPQSAATPALSNPHLTAVLQNKFGLSLLLILLSRGEDLQ    631 - 700
SSDPATESTQNNQWTEVMFMATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQLVQGIR    701 - 770
//

Text Mined References (30)

PMID Year Title