Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.30
PubTator Score 32.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 3.9e-03
osteosarcoma -2.659 7.6e-04
atypical teratoid / rhabdoid tumor -1.200 5.6e-03
non-small cell lung cancer -1.532 5.0e-17
lung cancer -1.400 4.1e-04
ulcerative colitis 2.300 2.6e-06
cystic fibrosis -1.100 1.6e-03
group 3 medulloblastoma -1.300 4.1e-03
Breast cancer -2.200 4.0e-09
ovarian cancer -2.600 5.4e-10

Synonym

Accession Q8N3A8 Q3KRB7 Q6DHZ1 Q9H754 PARP-8
Symbols ARTD16
pART16

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

AA Sequence

MGMCSRQERIQKDIDVVIQKSRAEKDCLFADFRYSDSTFTFTYVGGPRSVSYSVHVSEDYPDNTYVSSSE      1 - 70
NDEDVLVTTEPIPVIFHRIATELRKTNDINCCLSIKSKLQKENGEESRQNSTVEEDSEGDNDSEEFYYGG     71 - 140
QVNYDGELHKHPQLEADLSAVREIYGPHAVSLREYGAIDDVDIDLHIDVSFLDEEIAVAWEVIRTEPIIV    141 - 210
RLHCSLTQYLNGPVPTVDVFQISTKERFGLGHQLKKIMQTFVTQQWKQSKEKSNCLHNKKLSEKKVKSPL    211 - 280
HLFSTLRRSPSYPPPGCGKSKSKLKSEQDGISKTHKLLRRTCSSTVKTDDVCVTKSHRTFGRSLSSDPRA    281 - 350
EQAMTAIKSHKLLNRPCPAAVKSEECLTLKSHRLLTRSCSGDPRCEHNTNLKPHKLLSRSYSSNLRMEEL    351 - 420
YGLKNHKLLSKSYSSAPKSSKTELFKEPNAEGRRLSLTSGLIGILTPSSSSSSQLAPNGAKCIPVRDRGF    421 - 490
LVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQTLGVMNEAADEIATGAQVVDL    491 - 560
LVSMCRSALESPRKVVIFEPYPSVVDPNDPQMLAFNPRKKNYDRVMKALDSITSIREMTQAPYLEIKKQM    561 - 630
DKQDPLAHPLLQWVISSNRSHIVKLPVNRQLKFMHTPHQFLLLSSPPAKESNFRAAKKLFGSTFAFHGSH    631 - 700
IENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGMNKKQKVSAKDEPASSSKSSNTSQS    701 - 770
QKKGQQSQFLQSRNLKCIALCEVITSSDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIH    771 - 840
KEILRVIGNQTATG                                                            841 - 854
//

Text Mined References (15)

PMID Year Title
23874384 2013 Genetics of callous-unemotional behavior in children.
22685421 2012 Genetic variants on chromosome 1q41 influence ocular axial length and high myopia.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273990 2004 The PARP superfamily.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.