Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.71
PubTator Score 35.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 7.9e-07
psoriasis 6685 3.4e-04

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.500 3.4e-04
osteosarcoma -1.637 7.9e-07

Gene RIF (2)

PMID Text
25037261 ARTD15 plays role in nucleocytoplasmic shuttling, through karyopherin-beta1 mono-ADP-ribosylation. [review]
23103912 PARP16 is a tail-anchored endoplasmic reticulum protein required for the PERK- and IRE1alpha-mediated unfolded protein response.

AA Sequence

MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKE      1 - 70
LLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYE     71 - 140
TKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILS    141 - 210
CVAVCEVIDHPDVKCQTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKRAS    211 - 280
SQLSWFSSHWFTVMISLYLLLLLIVSVINSSAFQHFWNRAKR                                281 - 322
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25037261 2015 Regulation of nucleocytoplasmic transport by ADP-ribosylation: the emerging role of karyopherin-?1 mono-ADP-ribosylation by ARTD15.
23103912 2012 PARP16 is a tail-anchored endoplasmic reticulum protein required for the PERK- and IRE1?-mediated unfolded protein response.
22701565 2012 PARP16/ARTD15 is a novel endoplasmic-reticulum-associated mono-ADP-ribosyltransferase that interacts with, and modifies karyopherin-ß1.
22661712 2012 Crystal structure of human ADP-ribose transferase ARTD15/PARP16 reveals a novel putative regulatory domain.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
19946888 2010 Defining the membrane proteome of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273990 2004 The PARP superfamily.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.